Difference between revisions of "Os08g0524100"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
OsSRT1 is a widely expressed nuclear protein with higher levels in rapidly dividing tissues. OsSRT1 RNA interference induced an increase of histone H3K9 (lysine-9 of H3) acetylation and a decrease of H3K9 dimethylation, leading to H2O2 production, DNA fragmentation, cell death, and lesions mimicking plant hypersensitive responses during incompatible interactions with pathogens, whereas overexpression of OsSRT1 enhanced tolerance to oxidative stress. Transcript microarray analysis revealed that the transcription of many transposons and retrotransposons in addition to genes related to hypersensitive response and/or programmed cell death was activated. Chromatin immunoprecipitation assays showed that OsSRT1 down-regulation induced histone H3K9 acetylation on the transposable elements and some of the hypersensitive response-related genes, suggesting that these genes may be among the primary targets of deacetylation regulated by OsSRT1.The rice SIR2-like gene is required for safeguard against genome instability and cell damage to ensure plant cell growth, but likely implicates different molecular mechanisms than yeast and animal homologs.
 
OsSRT1 is a widely expressed nuclear protein with higher levels in rapidly dividing tissues. OsSRT1 RNA interference induced an increase of histone H3K9 (lysine-9 of H3) acetylation and a decrease of H3K9 dimethylation, leading to H2O2 production, DNA fragmentation, cell death, and lesions mimicking plant hypersensitive responses during incompatible interactions with pathogens, whereas overexpression of OsSRT1 enhanced tolerance to oxidative stress. Transcript microarray analysis revealed that the transcription of many transposons and retrotransposons in addition to genes related to hypersensitive response and/or programmed cell death was activated. Chromatin immunoprecipitation assays showed that OsSRT1 down-regulation induced histone H3K9 acetylation on the transposable elements and some of the hypersensitive response-related genes, suggesting that these genes may be among the primary targets of deacetylation regulated by OsSRT1.The rice SIR2-like gene is required for safeguard against genome instability and cell damage to ensure plant cell growth, but likely implicates different molecular mechanisms than yeast and animal homologs.
 +
 +
 +
Overexpression of OsSRT1 Enhanced Tolerance to Oxidative Stress
  
 
===Expression===
 
===Expression===

Revision as of 04:39, 26 May 2014

This gene belongs to Histone Deacetylase Gene family, which symbol is OsSRT1.

Annotated Information

Function

OsSRT1 is a widely expressed nuclear protein with higher levels in rapidly dividing tissues. OsSRT1 RNA interference induced an increase of histone H3K9 (lysine-9 of H3) acetylation and a decrease of H3K9 dimethylation, leading to H2O2 production, DNA fragmentation, cell death, and lesions mimicking plant hypersensitive responses during incompatible interactions with pathogens, whereas overexpression of OsSRT1 enhanced tolerance to oxidative stress. Transcript microarray analysis revealed that the transcription of many transposons and retrotransposons in addition to genes related to hypersensitive response and/or programmed cell death was activated. Chromatin immunoprecipitation assays showed that OsSRT1 down-regulation induced histone H3K9 acetylation on the transposable elements and some of the hypersensitive response-related genes, suggesting that these genes may be among the primary targets of deacetylation regulated by OsSRT1.The rice SIR2-like gene is required for safeguard against genome instability and cell damage to ensure plant cell growth, but likely implicates different molecular mechanisms than yeast and animal homologs.


Overexpression of OsSRT1 Enhanced Tolerance to Oxidative Stress

Expression

Please input expression information here. Baseline expression in tissue(s) was found for OS08G0524100.And no differential experiments were found for OS08G0524100.Related picture is shown as followed.

Expression.png

Evolution

Please input evolution information here. Recently, to identify potential genes that might promote drought tolerance during reproductive development in rice, we performed microarray experiments with floral RNAs from rice plants grown under normal and drought conditions, respectively (Jin et al. unpublished). Among droughtresponsive genes we identified, the OsDIL (Oryza sativa Drought-Induced LTP) gene, encoding a lipid transfer protein, was found to be up-regulated in flowers under drought. In this study, we report functional analyses of OsDIL and showed that OsDIL could enhance drought tolerance at the vegetative stage as well as the reproductive stage. In addition, part of the drought tolerance phenotypes could be attributed to the increased expression of several drought-responsive genes, altered expression of genes for ABA metabolism possibly resulting in elevated ABA levels, and enhanced functions of anther developmental genes, compared with wild-type. You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Structured Information

overview=

Gene Name

Os08g0524100

Description

Similar to Type II inositol-1,4,5-trisphosphate 5-phosphatase 12 (EC 3.1.3.36) (At5PTase12) (FRAGILE FIBER3 protein)

Version

NM_001068820.1 GI:115477377 GeneID:4346083

Length

7362 bp

Definition

Oryza sativa Japonica Group Os08g0524100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP

Chromosome = Chromosome 8

Chromosome

{{{Chromosome}}}

Location

Chromosome 8:26150471..26157832

Sequence Coding Region

26150586..26151303,26152182..26152434,26152524..26153328,26154075..26154199,26154328..26154412
,26154720..26154873,26154971..26155008,26155089..26155356,26155504..26155627
,26155755..26156115,26157151..26157543

Expression

GEO Profiles:Os08g0524100

Genome Context

<gbrowseImage1> name=NC_008401:26150471..26157832 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:26150471..26157832 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggactcggacgacgaggcggcggctgcggccatggcggcgcgggcgcgggagacgctgaggaagagcgcgtcgtcgtcgtcgtcgtcgccgtacgcgcgtagcaccgacgacggccccgtcgcctccgcctcgtgcgacgcgcgcctcgagcgctgctgccgcgaggttggcgccgcggtggcggtggtggaggagccggagcgggttgtttcggggggcggggcgttgccggagtttgttggtgagggagggggcgaggggatctaccgggtgccgctgcgcgccgcgatgcacccgggccgcccgccgccgctcgaggtgcggccccacccgctgcgggagacgcaggtggggtccttcctgcgggcgctggcgtgcgagccgcggcgccggcagctctgggcgggctccgagtccggggtccgcgtgtgggggctcgacgacgtgttcgccgccgccgggtgcggggcgcgccgcggcgacgaggagagcgcgcccttcagggagtccgtgcccgtgccgcccgtgctctgcgtcgaggcggacgcctcgaacgcgctggtgtggacgggccacaaggatgggaggatcatgtcgtggcgaatggacctcgccgccggcagcgacgacgatgacgcgccgttgttcagggaggccctgacgtggcaggcacacagccgcacgccagtgctctccatggtcatcacgtcttatggtgaaatatggtcaggatccgaagggggtgttataaaggcatggccctgggacgtcattgctaagtccctctcactaatgccagaagaaaaacatgtggctgctttacggattgaaaggtcatatattgaccttaggaacaatgcagcagctggcaacatatcttcgttccccgctgctgatgtgaaacacatgcttgctgaccattcccgggcaaaagtttggtgtttaactagcatggcatttgctgtttgggatgctcggaccagggaactgctaaaagtgtttggcatggacggccaaattgagtcagctcggttagaggcacctgtgatgccagagcaatttatagaggaagaaatcaaagcaaaacccgtgaagaaggataaaccacaaagctctttcaattttttccagaaatcaaggaatgccctgatgggagcagctggtgcagtacgcagagttgctacaaaagggacatttgttgaagataatcgccgaacagaagcagtggttcaggcaatgaatggaacggtttggtcaggttgcacagatggtttgatcattatgtgggatggaaatgggaaccgactgcaagaattccagcatcattgttcttctgttcagtgcatgaaggcacttggagaaagggtgtgggtgggctatgccagtggcattattcaagtcatggatgtggaaggtaaccttctggcagaatggactgggcatagctgtccggtcatacagatggcgattggtggttcttatgtctttactcttgctcatcatggtggaattagaggatggcctctagcttcccctggccctctggatgatattctgcgaactgaattgtcaaacagggagttgtcgtatagaaggctagtgaacattaaaatgcttgttgggacttggaatgttggccaggagaaagcatcttatgaatcactcatgtcatggttgggtcgtgcattttttgatgttgacttggtggtggttggtctacaagaggtcgagatgggtgctggtgttcttgccatggctgcagccaaagaaagtgtagggcttgagggtagtgccaatggtcagtggtggatagacaatattggcaggacccttgatgaggggatatccttccaccgagttggttcaaggcagctggctggattacttattgctgcatgggcaaggaaggaccttaagccacatgttggtgatgttgatgctgctgcagtaccatgtggctttgggcgtgctattggcaacaagggtggtgtagggttaagaattagagtctatgatcgcaggatatgttttgtgaacaatcattttgctgcacatctagaaaatgttagccgtcgtaatgctgattttgatcatatctatcgaacgatgacttttaacaaacctcatggatctgcagcttctgctacatctgttcaattgcataaaaccgtgaatgccaatggaaatcaggtcgatgaagatatacctgagatggcagaagctgatatggttgtctttcttggtgatttcaactaccgactttacggtatcacctatgatgaagcaagggacatggtctctcaaaggagctttgactggcttaaagaaagggatcaacttcaagcagaaatgagggcaggaaaggttttccaaggaatgcgtgaaggtttgatcagatttcctccgacttacaaattccaaagacacctaccaggtcttgcaggatatgactcgggtgagaagaagagaatacctgcttggtgcgacagaatactgtatcgagatagccgtgatgtattaacagcagagtgctcattagaatgccctgttgttgctaaaattacatcgtatgaagcttgcatgggtgtcacagatagtgatcataaaccagtgaggtgtgcatttagtgttgatattgcaagagtggatgagtttacaagaagacaggaatatggaaaaatactccaatctgacaaaagattacacagtttgcttcgagagtcccattttgttccagacactataatcagcacaaacaatataattttggaaaaccaagaacatgttgtcctccggataacaaatgattgtcaaagaaacaaggctgcttttgaaatcctgtgtgaaagccagtcaatcagcaagcaggatggaactaaatccgagtttcctccaagggcatcctttgggttgccgctttggcttgaggttgaaccatcagttggtctcattgaacctgggcaaacaatggaagttaccgtgcaccatgaagactattacacccaagaagtatttgtcaatggagtactgcagaactgttggtgcgaagtcaccagagataaggaggccgttcttttggtcaatgtaacaggtagcacctcaactgaaaccattacacacaggatcaatgtcaggcattgctgctcaacgatttctgcatccccgcccatcaatccaccgtctatcacaaccccatccgttgatgttctatcgggtgaagcatctacaagaagttcaaagaagaatccgttgaattatttgcaacgttctgactttaagccattcggcagctcagaggtgcatgatttgtgccccttgtga</cdnaseq>

Protein Sequence

<aaseq>MDSDDEAAAAAMAARARETLRKSASSSSSSPYARSTDDGPVASA SCDARLERCCREVGAAVAVVEEPERVVSGGGALPEFVGEGGGEGIYRVPLRAAMHPGR PPPLEVRPHPLRETQVGSFLRALACEPRRRQLWAGSESGVRVWGLDDVFAAAGCGARR GDEESAPFRESVPVPPVLCVEADASNALVWTGHKDGRIMSWRMDLAAGSDDDDAPLFR EALTWQAHSRTPVLSMVITSYGEIWSGSEGGVIKAWPWDVIAKSLSLMPEEKHVAALR IERSYIDLRNNAAAGNISSFPAADVKHMLADHSRAKVWCLTSMAFAVWDARTRELLKV FGMDGQIESARLEAPVMPEQFIEEEIKAKPVKKDKPQSSFNFFQKSRNALMGAAGAVR RVATKGTFVEDNRRTEAVVQAMNGTVWSGCTDGLIIMWDGNGNRLQEFQHHCSSVQCM KALGERVWVGYASGIIQVMDVEGNLLAEWTGHSCPVIQMAIGGSYVFTLAHHGGIRGW PLASPGPLDDILRTELSNRELSYRRLVNIKMLVGTWNVGQEKASYESLMSWLGRAFFD VDLVVVGLQEVEMGAGVLAMAAAKESVGLEGSANGQWWIDNIGRTLDEGISFHRVGSR QLAGLLIAAWARKDLKPHVGDVDAAAVPCGFGRAIGNKGGVGLRIRVYDRRICFVNNH FAAHLENVSRRNADFDHIYRTMTFNKPHGSAASATSVQLHKTVNANGNQVDEDIPEMA EADMVVFLGDFNYRLYGITYDEARDMVSQRSFDWLKERDQLQAEMRAGKVFQGMREGL IRFPPTYKFQRHLPGLAGYDSGEKKRIPAWCDRILYRDSRDVLTAECSLECPVVAKIT SYEACMGVTDSDHKPVRCAFSVDIARVDEFTRRQEYGKILQSDKRLHSLLRESHFVPD TIISTNNIILENQEHVVLRITNDCQRNKAAFEILCESQSISKQDGTKSEFPPRASFGL PLWLEVEPSVGLIEPGQTMEVTVHHEDYYTQEVFVNGVLQNCWCEVTRDKEAVLLVNV TGSTSTETITHRINVRHCCSTISASPPINPPSITTPSVDVLSGEASTRSSKKNPLNYL QRSDFKPFGSSEVHDLCPL</aaseq>

Gene Sequence

<dnaseqindica>116..833#1712..1964#2054..2858#3605..3729#3858..3942#4250..4403#4501..4538#4619..4886#5034..5157#5285..5645#6681..7073#atcgccatcgacgacgacgacgacgagctcgcctccccttcccttccctccacggcgcgccgcctccgcgacaggtcaccctcttcccttccatccaaacgagctcggatttaggatggactcggacgacgaggcggcggctgcggccatggcggcgcgggcgcgggagacgctgaggaagagcgcgtcgtcgtcgtcgtcgtcgccgtacgcgcgtagcaccgacgacggccccgtcgcctccgcctcgtgcgacgcgcgcctcgagcgctgctgccgcgaggttggcgccgcggtggcggtggtggaggagccggagcgggttgtttcggggggcggggcgttgccggagtttgttggtgagggagggggcgaggggatctaccgggtgccgctgcgcgccgcgatgcacccgggccgcccgccgccgctcgaggtgcggccccacccgctgcgggagacgcaggtggggtccttcctgcgggcgctggcgtgcgagccgcggcgccggcagctctgggcgggctccgagtccggggtccgcgtgtgggggctcgacgacgtgttcgccgccgccgggtgcggggcgcgccgcggcgacgaggagagcgcgcccttcagggagtccgtgcccgtgccgcccgtgctctgcgtcgaggcggacgcctcgaacgcgctggtgtggacgggccacaaggatgggaggatcatgtcgtggcgaatggacctcgccgccggcagcgacgacgatgacgcgccgttgttcagggaggccctgacgtggcaggcacacagccgcacgccagtgctctccatggtcatcacgtcttatggtgagaagcttgattacttactttgatcatctcaatcaattctatttttcattgagcaaattacgcaagggatggataaaaattggctccgtgcatagtgaggcaatagcattattgggtaaaagagcacgaagaatgattttagctgatgaaatgtttcattttagctgattttaagcgtctgaaaataacagggctttagcaacaactttagtctattacaaataaattaggaaaaacacttttggggggtggggtccagtaatattgacatcttgcaaatggaaaatctgaaagttgaactagtttttttttttctgttctgtatgacatgacatccatatatgggagtattagtgttagaagttttctcaaatggtaggcttccgttatcttttttagatgcgtttgcatggatgtaatcacttgggcgcgtttttctctttgcataaatgtggagaagtttgggaaggtaaaagtaacctaaaaaacatccacaaacaataggattagcctacgaaatgaacactcataccatagagaactttatcgaataatacaaataaatccttgttattcttgaaatattaagaaactgtctgttaataattgaagtcttaaagttcacttgtgttttagttgtctactatgtgaaaagcctacttggaagatgctttattgttgttccttttgaaacttaattttcagctttatttgttgcattggatcgctgtcaatggctgaatcattcattcgtagttatatgacattaaggcatctcttctgctccatacaagatttaaacttcacaatgtccactaaaagaggtagaacgttttgcaaaaatgatttatttcatttcaatatcttggaaacaggtgaaatatggtcaggatccgaagggggtgttataaaggcatggccctgggacgtcattgctaagtccctctcactaatgccagaagaaaaacatgtggctgctttacggattgaaaggtcatatattgaccttaggaacaatgcagcagctggcaacatatcttcgttccccgctgctgatgtgaaacacatgcttgctgaccattcccgggcaaaagtttggtgtttaactagcatggcatttgctgtttggtatgctttcataaataaattgcattatccttgagttcatcggcccattgaaaagttaggaactattttttctgatatttttcctgtagggatgctcggaccagggaactgctaaaagtgtttggcatggacggccaaattgagtcagctcggttagaggcacctgtgatgccagagcaatttatagaggaagaaatcaaagcaaaacccgtgaagaaggataaaccacaaagctctttcaattttttccagaaatcaaggaatgccctgatgggagcagctggtgcagtacgcagagttgctacaaaagggacatttgttgaagataatcgccgaacagaagcagtggttcaggcaatgaatggaacggtttggtcaggttgcacagatggtttgatcattatgtgggatggaaatgggaaccgactgcaagaattccagcatcattgttcttctgttcagtgcatgaaggcacttggagaaagggtgtgggtgggctatgccagtggcattattcaagtcatggatgtggaaggtaaccttctggcagaatggactgggcatagctgtccggtcatacagatggcgattggtggttcttatgtctttactcttgctcatcatggtggaattagaggatggcctctagcttcccctggccctctggatgatattctgcgaactgaattgtcaaacagggagttgtcgtatagaaggctagtgaacattaaaatgcttgttgggacttggaatgttggccaggagaaagcatcttatgaatcactcatgtcatggttgggtcgtgcattttttgatgttgacttggtggtggttggtctacaagaggtcgagatgggtgctggtgttcttgccatggctgcagccaaagaaagtgtaagatatgaaatactcaaccctacctttgatttcgttgtttcattgttttcttgctcggttcaatcaaggaaaaagaaactattattgagataggaaaataggttactagtgagcacaataagattatttctgcattacagcttaatttgtattatttctgataatatgactgtatctgcgctactgtcttttgaaaaacacaagtggtgtgcttgtctttctgataaaatggttgtactatgttacattttaatttttatccttcttatctctatctggagctcatatgattctaatttagctgcttgaaacaaatactgcatatacctaagcataagggttcattctagagctctaggtgcagattacctttttacagttttttttttgtgagaaggcacaggagaactgtgtatatttctgttagtataaaaatgatgaacactgaaactgaagttaagagttgtcttttacagttattgcagctgtatgtttgggaagtcaatgcatttgctttcatgctagtttgtttgctgtggtgttttattggtataataaagctaccactgagaactggaaggaaaatttaatttaatttcctatctggtcatcatctcccccttcttcctgtttctgtctgattttcatatctagactgcactgggctatttcctgtactggtatcatgcctgctatgtgagttttgagcattttattcaacatttcttgctttatggccttaggtagggcttgagggtagtgccaatggtcagtggtggatagacaatattggcaggacccttgatgaggggatatccttccaccgagttggttcaaggcagctggctggattacttattgctgcatggtactggtttatcttaaaaccatttcttagtgaaacatttttctgttattatataattatcattttttttgcacttttgtacttttctcatacgatatgtatggcatgtacatcatgataatttcaagggcaaggaaggaccttaagccacatgttggtgatgttgatgctgctgcagtaccatgtggctttgggcgtgctattggcaacaaggtacatgattgtcaaaatgtttattaactgtttgttcttgagcgtatcatatgtgcactataccaactgggaatttcgttcacgcaaagaacattatactgctgtgataaataatcatgggatactcaaaatatgtttttcttcacatacttcatccaactagaaacaatttgtgagcgtgcaatggttagaggtgaaagtgtgcagctgcagttttcagaggaaaattattttaatagttagcaatatattgctctattctttttcctattttgcattgaataatgatatctcattcttcttgcagggtggtgtagggttaagaattagagtctatgatcgcaggatatgttttgtgaacaatcattttgctgcacatctagaaaatgttagccgtcgtaatgctgattttgatcatatctatcgaacgatgacttttaacaaacctcatggatctgcaggtacttcattctcaactttcatcttataagtatatttaaatactagtttgttgtaaatgaattctataacatcttttttttttggtttcctctacagcttctgctacatctgttcaattgcataaaaccgtgaatgtatgtaatcgctgaactgcattgcagatttttccgtggaaataaagaatacttatttatagctattgtcataatggcaggccaatggaaatcaggtcgatgaagatatacctgagatggcagaagctgatatggttgtctttcttggtgatttcaactaccgactttacggtatcacctatgatgaagcaagggacatggtctctcaaaggagctttgactggcttaaagaaagggatcaacttcaagcagaaatgagggcaggaaaggttttccaaggaatgcgtgaaggtttgatcagatttcctccgacttacaaattccaaagacacctaccaggtcttgcaggtatggcctgtttttacttttgatgctagcggcacctccttaattaaatagttccagttctgtcacaagattcaaatgttcttttatgtgctgattaaattgacgcaactgctttggagctaatttttccacaccaaaaataattaggatatgactcgggtgagaagaagagaatacctgcttggtgcgacagaatactgtatcgagatagccgtgatgtattaacagcagagtgctcattagaatgccctgttgttgctaaaattacatcgtaagattctacaacttaccagttaccactcgttttgagaaggagaatctaagacacacatgttgttttgtcttgatcataatcactccctcatacataatttgatgttttattgctcttctggtaggtatgaagcttgcatgggtgtcacagatagtgatcataaaccagtgaggtgtgcatttagtgttgatattgcaagagtggatgagtttacaagaagacaggaatatggaaaaatactccaatctgacaaaagattacacagtttgcttcgagagtcccattttgttccagacactataatcagcacaaacaatataattttggaaaaccaagaacatgttgtcctccggataacaaatgattgtcaaagaaacaaggctgcttttgaaatcctgtgtgaaagccagtcaatcagcaagcaggatggaactaaatccgagtttcctccaagggcatcctttgggttgccgctttggcttgaggtatgcattaatatgtttatttgtttattcctgcattcatttttttcttttgtttagtcttaaaacccattgtgtttttcccttattaagaaaaaagaaaacccatagtgttacactctcagttgagtgttctatttctatctgtagtgttgaccattcttttgcttgtatatagaaagcctgttaagttcaaaaccatagaaagtctgtccattatgtattcagtttgcaagacctaaaataaaatttagctcataaatatagaagatatcttgtcattctagaatatgaattttggacaaccatggaacctatatactcccctcacataatgtaaaagagaagggatggagtattttacttctatgacatgcactttctgtatcagctgcactccaacctctttgtgagaactatatcagactttcttttaattatgagaaagcaaactgaaggaaaaaaattgcaaaagcaaatgagatgaaacacaatttcgatcaccttgtacctagacagtcatggaggtgggctcaggtttggttgcatgtattgtcttctagtggtcatttaggatactctttgtggacatatatttggtcaaaatcataccaaactttgcatgagttgatagacaacatcatatgatcatatctgtcagtgctcagttcataaatgtgtttcagccaaaaatcctaatgcctcatttgcatgaacccaaatcctggcctatccacatctatgggctaggattttagctcaaattcccaacccatcccatacacgtggatgggctgccatttaacccatccatataagcctaaactggatatggatctcagtggagttgctgactgaccagtttgtcatgacagtcaacagacaagaacagctgctaccactaaccattcataacaagccttttgacttgagtgttatactagtttattatatttttcagtgctttgcatgttccattttgcttttcacagtaccaatatttggtaatttaatcattcatcgtgctatgttttacaggttgaaccatcagttggtctcattgaacctgggcaaacaatggaagttaccgtgcaccatgaagactattacacccaagaagtatttgtcaatggagtactgcagaactgttggtgcgaagtcaccagagataaggaggccgttcttttggtcaatgtaacaggtagcacctcaactgaaaccattacacacaggatcaatgtcaggcattgctgctcaacgatttctgcatccccgcccatcaatccaccgtctatcacaaccccatccgttgatgttctatcgggtgaagcatctacaagaagttcaaagaagaatccgttgaattatttgcaacgttctgactttaagccattcggcagctcagaggtgcatgatttgtgccccttgtgaaacatgtaaaaatgagtgtgtctgtgtgtttttgtctgtttggtgtagcagttctgtataggagttgagtcttacgttacttaccaaagggagaattaaggtgtcccactgttaattctgtagatattcaccactgacttctcaccattcgttgagtaacatcagaaaggaaatgtgtgcatagttacaagatatctcatgtagtttttttttttcctcttctttttatagaggacacatggtgatacaaaatattctttacaggttgaatacaaagaaagttacttcg</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0524100, RefSeq:Os08g0524100