Difference between revisions of "Os08g0524100"

From RiceWiki
Jump to: navigation, search
(References)
(References)
Line 50: Line 50:
 
<ref name="ref2"></ref> Rice histone deacetylase genes display specific expression patterns and developmental functions
 
<ref name="ref2"></ref> Rice histone deacetylase genes display specific expression patterns and developmental functions
  
<ref name="ref3"></ref>Involvement of Histone Modifications in Plant Abiotic Stress Responses
+
<ref name="ref3"></ref> Involvement of Histone Modifications in Plant Abiotic Stress Responses
  
<ref name="ref4"></ref>Arabidopsis Putative Deacetylase AtSRT2 Regulates Basal Defense by Suppressing PAD4, EDS5 and SID2 Expression
+
<ref name="ref4"></ref> Arabidopsis Putative Deacetylase AtSRT2 Regulates Basal Defense by Suppressing PAD4, EDS5 and SID2 Expression
  
<ref name="ref5"></ref>HISTONE DEACETYLASE6 Interacts with FLOWERING LOCUS D and Regulates Flowering in Arabidopsis
+
<ref name="ref5"></ref> HISTONE DEACETYLASE6 Interacts with FLOWERING LOCUS D and Regulates Flowering in Arabidopsis
  
<ref name="ref6"></ref>Rice epigenomics and epigenetics: challenges and opportunities
+
<ref name="ref6"></ref> Rice epigenomics and epigenetics: challenges and opportunities
  
<ref name="ref7"></ref>Regulatory Function of Histone Modifications in Controlling Rice Gene Expression and Plant Growth
+
<ref name="ref7"></ref> Regulatory Function of Histone Modifications in Controlling Rice Gene Expression and Plant Growth
  
<ref name="ref8"></ref>A comparative transcriptomic analysis of the extremely boron tolerant plant Puccinellia distans with the moderately boron tolerant Gypsophila arrostil
+
<ref name="ref8"></ref> A comparative transcriptomic analysis of the extremely boron tolerant plant Puccinellia distans with the moderately boron tolerant Gypsophila arrostil
  
 
==Structured Information==
 
==Structured Information==

Revision as of 05:44, 26 May 2014

This gene belongs to Histone Deacetylase Gene family, which symbol is OsSRT1.

Annotated Information

Function

OsSRT1 is a widely expressed nuclear protein with higher levels in rapidly dividing tissues. OsSRT1 RNA interference induced an increase of histone H3K9 (lysine-9 of H3) acetylation and a decrease of H3K9 dimethylation, leading to H2O2 production, DNA fragmentation, cell death, and lesions mimicking plant hypersensitive responses during incompatible interactions with pathogens, whereas overexpression of OsSRT1 enhanced tolerance to oxidative stress. Transcript microarray analysis revealed that the transcription of many transposons and retrotransposons in addition to genes related to hypersensitive response and/or programmed cell death was activated. Chromatin immunoprecipitation assays showed that OsSRT1 down-regulation induced histone H3K9 acetylation on the transposable elements and some of the hypersensitive response-related genes, suggesting that these genes may be among the primary targets of deacetylation regulated by OsSRT1.The rice SIR2-like gene is required for safeguard against genome instability and cell damage to ensure plant cell growth, but likely implicates different molecular mechanisms than yeast and animal homologs. Overexpression of OsSRT1 Enhanced Tolerance to Oxidative Stress


[1]

Expression

Please input expression information here. Baseline expression in tissue(s) was found for OS08G0524100.And no differential experiments were found for OS08G0524100.Related picture is shown as followed.

Expression.png

Evolution

Rice Genome Contains Two SIR2-Related Genes(figure 1A,2A,2B)

1A.png 2A 2B.png3.png

Down-Regulation of OsSRT1 by RNAi Induced Programmed Cell Death in Rice.the OsSRT1 RNAi had little effect on overall histone H3 acetylation. However, the acetylation of H3K9 was induced, whereas the dimethylation of H3K9 was reduced, in agreement with the antagonistic relationship between H3K9 acetylation and dimethylation(3A,3B,3C)


Overexpression of OsSRT1 Enhanced Tolerance to Oxidative Stress. Transcriptomic Analysis Revealed Activation of ManyTransposon and PCD-Related Genes. OsSRT1 RNAi Induced Histone H3K9 Acetylation on Transposable Elements.

4.png5.png6.png

Labs working on this gene

Benhamed M, Bertrand C, Servet C, Zhou DX Blander G, Guarente L Brodersen P, PetersenM, Pike HM, Olszak B, Skov S, Odum N Carrozza MJ, Utley RT, Workman JL, Coˆ te´ J Chu Z, Yuan M, Yao J, Ge X, Yuan B, Xu C, Li X, Fu B, Li Z, Bennetzen JL, Czernic P, Huang HC, Marco Y DaiM, Hu Y, Zhao Y, Liu H, Zhou D-X Donahue JL, Okpodu CM, Cramer CL, Grabau EA, Alscher RG

References

[1] Down-Regulation of a SILENT INFORMATION REGULATOR2-Related Histone Deacetylase Gene, OsSRT1,Induces DNA Fragmentation and Cell Death in RiceRice1.

[2] Rice histone deacetylase genes display specific expression patterns and developmental functions

[3] Involvement of Histone Modifications in Plant Abiotic Stress Responses

[4] Arabidopsis Putative Deacetylase AtSRT2 Regulates Basal Defense by Suppressing PAD4, EDS5 and SID2 Expression

[5] HISTONE DEACETYLASE6 Interacts with FLOWERING LOCUS D and Regulates Flowering in Arabidopsis

[6] Rice epigenomics and epigenetics: challenges and opportunities

[7] Regulatory Function of Histone Modifications in Controlling Rice Gene Expression and Plant Growth

[8] A comparative transcriptomic analysis of the extremely boron tolerant plant Puccinellia distans with the moderately boron tolerant Gypsophila arrostil

Structured Information

overview=

Gene Name

Os08g0524100

Description

Similar to Type II inositol-1,4,5-trisphosphate 5-phosphatase 12 (EC 3.1.3.36) (At5PTase12) (FRAGILE FIBER3 protein)

Version

NM_001068820.1 GI:115477377 GeneID:4346083

Length

7362 bp

Definition

Oryza sativa Japonica Group Os08g0524100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP

Chromosome = Chromosome 8

Chromosome

{{{Chromosome}}}

Location

Chromosome 8:26150471..26157832

Sequence Coding Region

26150586..26151303,26152182..26152434,26152524..26153328,26154075..26154199,26154328..26154412
,26154720..26154873,26154971..26155008,26155089..26155356,26155504..26155627
,26155755..26156115,26157151..26157543

Expression

GEO Profiles:Os08g0524100

Genome Context

<gbrowseImage1> name=NC_008401:26150471..26157832 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:26150471..26157832 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggactcggacgacgaggcggcggctgcggccatggcggcgcgggcgcgggagacgctgaggaagagcgcgtcgtcgtcgtcgtcgtcgccgtacgcgcgtagcaccgacgacggccccgtcgcctccgcctcgtgcgacgcgcgcctcgagcgctgctgccgcgaggttggcgccgcggtggcggtggtggaggagccggagcgggttgtttcggggggcggggcgttgccggagtttgttggtgagggagggggcgaggggatctaccgggtgccgctgcgcgccgcgatgcacccgggccgcccgccgccgctcgaggtgcggccccacccgctgcgggagacgcaggtggggtccttcctgcgggcgctggcgtgcgagccgcggcgccggcagctctgggcgggctccgagtccggggtccgcgtgtgggggctcgacgacgtgttcgccgccgccgggtgcggggcgcgccgcggcgacgaggagagcgcgcccttcagggagtccgtgcccgtgccgcccgtgctctgcgtcgaggcggacgcctcgaacgcgctggtgtggacgggccacaaggatgggaggatcatgtcgtggcgaatggacctcgccgccggcagcgacgacgatgacgcgccgttgttcagggaggccctgacgtggcaggcacacagccgcacgccagtgctctccatggtcatcacgtcttatggtgaaatatggtcaggatccgaagggggtgttataaaggcatggccctgggacgtcattgctaagtccctctcactaatgccagaagaaaaacatgtggctgctttacggattgaaaggtcatatattgaccttaggaacaatgcagcagctggcaacatatcttcgttccccgctgctgatgtgaaacacatgcttgctgaccattcccgggcaaaagtttggtgtttaactagcatggcatttgctgtttgggatgctcggaccagggaactgctaaaagtgtttggcatggacggccaaattgagtcagctcggttagaggcacctgtgatgccagagcaatttatagaggaagaaatcaaagcaaaacccgtgaagaaggataaaccacaaagctctttcaattttttccagaaatcaaggaatgccctgatgggagcagctggtgcagtacgcagagttgctacaaaagggacatttgttgaagataatcgccgaacagaagcagtggttcaggcaatgaatggaacggtttggtcaggttgcacagatggtttgatcattatgtgggatggaaatgggaaccgactgcaagaattccagcatcattgttcttctgttcagtgcatgaaggcacttggagaaagggtgtgggtgggctatgccagtggcattattcaagtcatggatgtggaaggtaaccttctggcagaatggactgggcatagctgtccggtcatacagatggcgattggtggttcttatgtctttactcttgctcatcatggtggaattagaggatggcctctagcttcccctggccctctggatgatattctgcgaactgaattgtcaaacagggagttgtcgtatagaaggctagtgaacattaaaatgcttgttgggacttggaatgttggccaggagaaagcatcttatgaatcactcatgtcatggttgggtcgtgcattttttgatgttgacttggtggtggttggtctacaagaggtcgagatgggtgctggtgttcttgccatggctgcagccaaagaaagtgtagggcttgagggtagtgccaatggtcagtggtggatagacaatattggcaggacccttgatgaggggatatccttccaccgagttggttcaaggcagctggctggattacttattgctgcatgggcaaggaaggaccttaagccacatgttggtgatgttgatgctgctgcagtaccatgtggctttgggcgtgctattggcaacaagggtggtgtagggttaagaattagagtctatgatcgcaggatatgttttgtgaacaatcattttgctgcacatctagaaaatgttagccgtcgtaatgctgattttgatcatatctatcgaacgatgacttttaacaaacctcatggatctgcagcttctgctacatctgttcaattgcataaaaccgtgaatgccaatggaaatcaggtcgatgaagatatacctgagatggcagaagctgatatggttgtctttcttggtgatttcaactaccgactttacggtatcacctatgatgaagcaagggacatggtctctcaaaggagctttgactggcttaaagaaagggatcaacttcaagcagaaatgagggcaggaaaggttttccaaggaatgcgtgaaggtttgatcagatttcctccgacttacaaattccaaagacacctaccaggtcttgcaggatatgactcgggtgagaagaagagaatacctgcttggtgcgacagaatactgtatcgagatagccgtgatgtattaacagcagagtgctcattagaatgccctgttgttgctaaaattacatcgtatgaagcttgcatgggtgtcacagatagtgatcataaaccagtgaggtgtgcatttagtgttgatattgcaagagtggatgagtttacaagaagacaggaatatggaaaaatactccaatctgacaaaagattacacagtttgcttcgagagtcccattttgttccagacactataatcagcacaaacaatataattttggaaaaccaagaacatgttgtcctccggataacaaatgattgtcaaagaaacaaggctgcttttgaaatcctgtgtgaaagccagtcaatcagcaagcaggatggaactaaatccgagtttcctccaagggcatcctttgggttgccgctttggcttgaggttgaaccatcagttggtctcattgaacctgggcaaacaatggaagttaccgtgcaccatgaagactattacacccaagaagtatttgtcaatggagtactgcagaactgttggtgcgaagtcaccagagataaggaggccgttcttttggtcaatgtaacaggtagcacctcaactgaaaccattacacacaggatcaatgtcaggcattgctgctcaacgatttctgcatccccgcccatcaatccaccgtctatcacaaccccatccgttgatgttctatcgggtgaagcatctacaagaagttcaaagaagaatccgttgaattatttgcaacgttctgactttaagccattcggcagctcagaggtgcatgatttgtgccccttgtga</cdnaseq>

Protein Sequence

<aaseq>MDSDDEAAAAAMAARARETLRKSASSSSSSPYARSTDDGPVASA SCDARLERCCREVGAAVAVVEEPERVVSGGGALPEFVGEGGGEGIYRVPLRAAMHPGR PPPLEVRPHPLRETQVGSFLRALACEPRRRQLWAGSESGVRVWGLDDVFAAAGCGARR GDEESAPFRESVPVPPVLCVEADASNALVWTGHKDGRIMSWRMDLAAGSDDDDAPLFR EALTWQAHSRTPVLSMVITSYGEIWSGSEGGVIKAWPWDVIAKSLSLMPEEKHVAALR IERSYIDLRNNAAAGNISSFPAADVKHMLADHSRAKVWCLTSMAFAVWDARTRELLKV FGMDGQIESARLEAPVMPEQFIEEEIKAKPVKKDKPQSSFNFFQKSRNALMGAAGAVR RVATKGTFVEDNRRTEAVVQAMNGTVWSGCTDGLIIMWDGNGNRLQEFQHHCSSVQCM KALGERVWVGYASGIIQVMDVEGNLLAEWTGHSCPVIQMAIGGSYVFTLAHHGGIRGW PLASPGPLDDILRTELSNRELSYRRLVNIKMLVGTWNVGQEKASYESLMSWLGRAFFD VDLVVVGLQEVEMGAGVLAMAAAKESVGLEGSANGQWWIDNIGRTLDEGISFHRVGSR QLAGLLIAAWARKDLKPHVGDVDAAAVPCGFGRAIGNKGGVGLRIRVYDRRICFVNNH FAAHLENVSRRNADFDHIYRTMTFNKPHGSAASATSVQLHKTVNANGNQVDEDIPEMA EADMVVFLGDFNYRLYGITYDEARDMVSQRSFDWLKERDQLQAEMRAGKVFQGMREGL IRFPPTYKFQRHLPGLAGYDSGEKKRIPAWCDRILYRDSRDVLTAECSLECPVVAKIT SYEACMGVTDSDHKPVRCAFSVDIARVDEFTRRQEYGKILQSDKRLHSLLRESHFVPD TIISTNNIILENQEHVVLRITNDCQRNKAAFEILCESQSISKQDGTKSEFPPRASFGL PLWLEVEPSVGLIEPGQTMEVTVHHEDYYTQEVFVNGVLQNCWCEVTRDKEAVLLVNV TGSTSTETITHRINVRHCCSTISASPPINPPSITTPSVDVLSGEASTRSSKKNPLNYL QRSDFKPFGSSEVHDLCPL</aaseq>

Gene Sequence

<dnaseqindica>116..833#1712..1964#2054..2858#3605..3729#3858..3942#4250..4403#4501..4538#4619..4886#5034..5157#5285..5645#6681..7073#atcgccatcgacgacgacgacgacgagctcgcctccccttcccttccctccacggcgcgccgcctccgcgacaggtcaccctcttcccttccatccaaacgagctcggatttaggatggactcggacgacgaggcggcggctgcggccatggcggcgcgggcgcgggagacgctgaggaagagcgcgtcgtcgtcgtcgtcgtcgccgtacgcgcgtagcaccgacgacggccccgtcgcctccgcctcgtgcgacgcgcgcctcgagcgctgctgccgcgaggttggcgccgcggtggcggtggtggaggagccggagcgggttgtttcggggggcggggcgttgccggagtttgttggtgagggagggggcgaggggatctaccgggtgccgctgcgcgccgcgatgcacccgggccgcccgccgccgctcgaggtgcggccccacccgctgcgggagacgcaggtggggtccttcctgcgggcgctggcgtgcgagccgcggcgccggcagctctgggcgggctccgagtccggggtccgcgtgtgggggctcgacgacgtgttcgccgccgccgggtgcggggcgcgccgcggcgacgaggagagcgcgcccttcagggagtccgtgcccgtgccgcccgtgctctgcgtcgaggcggacgcctcgaacgcgctggtgtggacgggccacaaggatgggaggatcatgtcgtggcgaatggacctcgccgccggcagcgacgacgatgacgcgccgttgttcagggaggccctgacgtggcaggcacacagccgcacgccagtgctctccatggtcatcacgtcttatggtgagaagcttgattacttactttgatcatctcaatcaattctatttttcattgagcaaattacgcaagggatggataaaaattggctccgtgcatagtgaggcaatagcattattgggtaaaagagcacgaagaatgattttagctgatgaaatgtttcattttagctgattttaagcgtctgaaaataacagggctttagcaacaactttagtctattacaaataaattaggaaaaacacttttggggggtggggtccagtaatattgacatcttgcaaatggaaaatctgaaagttgaactagtttttttttttctgttctgtatgacatgacatccatatatgggagtattagtgttagaagttttctcaaatggtaggcttccgttatcttttttagatgcgtttgcatggatgtaatcacttgggcgcgtttttctctttgcataaatgtggagaagtttgggaaggtaaaagtaacctaaaaaacatccacaaacaataggattagcctacgaaatgaacactcataccatagagaactttatcgaataatacaaataaatccttgttattcttgaaatattaagaaactgtctgttaataattgaagtcttaaagttcacttgtgttttagttgtctactatgtgaaaagcctacttggaagatgctttattgttgttccttttgaaacttaattttcagctttatttgttgcattggatcgctgtcaatggctgaatcattcattcgtagttatatgacattaaggcatctcttctgctccatacaagatttaaacttcacaatgtccactaaaagaggtagaacgttttgcaaaaatgatttatttcatttcaatatcttggaaacaggtgaaatatggtcaggatccgaagggggtgttataaaggcatggccctgggacgtcattgctaagtccctctcactaatgccagaagaaaaacatgtggctgctttacggattgaaaggtcatatattgaccttaggaacaatgcagcagctggcaacatatcttcgttccccgctgctgatgtgaaacacatgcttgctgaccattcccgggcaaaagtttggtgtttaactagcatggcatttgctgtttggtatgctttcataaataaattgcattatccttgagttcatcggcccattgaaaagttaggaactattttttctgatatttttcctgtagggatgctcggaccagggaactgctaaaagtgtttggcatggacggccaaattgagtcagctcggttagaggcacctgtgatgccagagcaatttatagaggaagaaatcaaagcaaaacccgtgaagaaggataaaccacaaagctctttcaattttttccagaaatcaaggaatgccctgatgggagcagctggtgcagtacgcagagttgctacaaaagggacatttgttgaagataatcgccgaacagaagcagtggttcaggcaatgaatggaacggtttggtcaggttgcacagatggtttgatcattatgtgggatggaaatgggaaccgactgcaagaattccagcatcattgttcttctgttcagtgcatgaaggcacttggagaaagggtgtgggtgggctatgccagtggcattattcaagtcatggatgtggaaggtaaccttctggcagaatggactgggcatagctgtccggtcatacagatggcgattggtggttcttatgtctttactcttgctcatcatggtggaattagaggatggcctctagcttcccctggccctctggatgatattctgcgaactgaattgtcaaacagggagttgtcgtatagaaggctagtgaacattaaaatgcttgttgggacttggaatgttggccaggagaaagcatcttatgaatcactcatgtcatggttgggtcgtgcattttttgatgttgacttggtggtggttggtctacaagaggtcgagatgggtgctggtgttcttgccatggctgcagccaaagaaagtgtaagatatgaaatactcaaccctacctttgatttcgttgtttcattgttttcttgctcggttcaatcaaggaaaaagaaactattattgagataggaaaataggttactagtgagcacaataagattatttctgcattacagcttaatttgtattatttctgataatatgactgtatctgcgctactgtcttttgaaaaacacaagtggtgtgcttgtctttctgataaaatggttgtactatgttacattttaatttttatccttcttatctctatctggagctcatatgattctaatttagctgcttgaaacaaatactgcatatacctaagcataagggttcattctagagctctaggtgcagattacctttttacagttttttttttgtgagaaggcacaggagaactgtgtatatttctgttagtataaaaatgatgaacactgaaactgaagttaagagttgtcttttacagttattgcagctgtatgtttgggaagtcaatgcatttgctttcatgctagtttgtttgctgtggtgttttattggtataataaagctaccactgagaactggaaggaaaatttaatttaatttcctatctggtcatcatctcccccttcttcctgtttctgtctgattttcatatctagactgcactgggctatttcctgtactggtatcatgcctgctatgtgagttttgagcattttattcaacatttcttgctttatggccttaggtagggcttgagggtagtgccaatggtcagtggtggatagacaatattggcaggacccttgatgaggggatatccttccaccgagttggttcaaggcagctggctggattacttattgctgcatggtactggtttatcttaaaaccatttcttagtgaaacatttttctgttattatataattatcattttttttgcacttttgtacttttctcatacgatatgtatggcatgtacatcatgataatttcaagggcaaggaaggaccttaagccacatgttggtgatgttgatgctgctgcagtaccatgtggctttgggcgtgctattggcaacaaggtacatgattgtcaaaatgtttattaactgtttgttcttgagcgtatcatatgtgcactataccaactgggaatttcgttcacgcaaagaacattatactgctgtgataaataatcatgggatactcaaaatatgtttttcttcacatacttcatccaactagaaacaatttgtgagcgtgcaatggttagaggtgaaagtgtgcagctgcagttttcagaggaaaattattttaatagttagcaatatattgctctattctttttcctattttgcattgaataatgatatctcattcttcttgcagggtggtgtagggttaagaattagagtctatgatcgcaggatatgttttgtgaacaatcattttgctgcacatctagaaaatgttagccgtcgtaatgctgattttgatcatatctatcgaacgatgacttttaacaaacctcatggatctgcaggtacttcattctcaactttcatcttataagtatatttaaatactagtttgttgtaaatgaattctataacatcttttttttttggtttcctctacagcttctgctacatctgttcaattgcataaaaccgtgaatgtatgtaatcgctgaactgcattgcagatttttccgtggaaataaagaatacttatttatagctattgtcataatggcaggccaatggaaatcaggtcgatgaagatatacctgagatggcagaagctgatatggttgtctttcttggtgatttcaactaccgactttacggtatcacctatgatgaagcaagggacatggtctctcaaaggagctttgactggcttaaagaaagggatcaacttcaagcagaaatgagggcaggaaaggttttccaaggaatgcgtgaaggtttgatcagatttcctccgacttacaaattccaaagacacctaccaggtcttgcaggtatggcctgtttttacttttgatgctagcggcacctccttaattaaatagttccagttctgtcacaagattcaaatgttcttttatgtgctgattaaattgacgcaactgctttggagctaatttttccacaccaaaaataattaggatatgactcgggtgagaagaagagaatacctgcttggtgcgacagaatactgtatcgagatagccgtgatgtattaacagcagagtgctcattagaatgccctgttgttgctaaaattacatcgtaagattctacaacttaccagttaccactcgttttgagaaggagaatctaagacacacatgttgttttgtcttgatcataatcactccctcatacataatttgatgttttattgctcttctggtaggtatgaagcttgcatgggtgtcacagatagtgatcataaaccagtgaggtgtgcatttagtgttgatattgcaagagtggatgagtttacaagaagacaggaatatggaaaaatactccaatctgacaaaagattacacagtttgcttcgagagtcccattttgttccagacactataatcagcacaaacaatataattttggaaaaccaagaacatgttgtcctccggataacaaatgattgtcaaagaaacaaggctgcttttgaaatcctgtgtgaaagccagtcaatcagcaagcaggatggaactaaatccgagtttcctccaagggcatcctttgggttgccgctttggcttgaggtatgcattaatatgtttatttgtttattcctgcattcatttttttcttttgtttagtcttaaaacccattgtgtttttcccttattaagaaaaaagaaaacccatagtgttacactctcagttgagtgttctatttctatctgtagtgttgaccattcttttgcttgtatatagaaagcctgttaagttcaaaaccatagaaagtctgtccattatgtattcagtttgcaagacctaaaataaaatttagctcataaatatagaagatatcttgtcattctagaatatgaattttggacaaccatggaacctatatactcccctcacataatgtaaaagagaagggatggagtattttacttctatgacatgcactttctgtatcagctgcactccaacctctttgtgagaactatatcagactttcttttaattatgagaaagcaaactgaaggaaaaaaattgcaaaagcaaatgagatgaaacacaatttcgatcaccttgtacctagacagtcatggaggtgggctcaggtttggttgcatgtattgtcttctagtggtcatttaggatactctttgtggacatatatttggtcaaaatcataccaaactttgcatgagttgatagacaacatcatatgatcatatctgtcagtgctcagttcataaatgtgtttcagccaaaaatcctaatgcctcatttgcatgaacccaaatcctggcctatccacatctatgggctaggattttagctcaaattcccaacccatcccatacacgtggatgggctgccatttaacccatccatataagcctaaactggatatggatctcagtggagttgctgactgaccagtttgtcatgacagtcaacagacaagaacagctgctaccactaaccattcataacaagccttttgacttgagtgttatactagtttattatatttttcagtgctttgcatgttccattttgcttttcacagtaccaatatttggtaatttaatcattcatcgtgctatgttttacaggttgaaccatcagttggtctcattgaacctgggcaaacaatggaagttaccgtgcaccatgaagactattacacccaagaagtatttgtcaatggagtactgcagaactgttggtgcgaagtcaccagagataaggaggccgttcttttggtcaatgtaacaggtagcacctcaactgaaaccattacacacaggatcaatgtcaggcattgctgctcaacgatttctgcatccccgcccatcaatccaccgtctatcacaaccccatccgttgatgttctatcgggtgaagcatctacaagaagttcaaagaagaatccgttgaattatttgcaacgttctgactttaagccattcggcagctcagaggtgcatgatttgtgccccttgtgaaacatgtaaaaatgagtgtgtctgtgtgtttttgtctgtttggtgtagcagttctgtataggagttgagtcttacgttacttaccaaagggagaattaaggtgtcccactgttaattctgtagatattcaccactgacttctcaccattcgttgagtaacatcagaaaggaaatgtgtgcatagttacaagatatctcatgtagtttttttttttcctcttctttttatagaggacacatggtgatacaaaatattctttacaggttgaatacaaagaaagttacttcg</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0524100, RefSeq:Os08g0524100

  1. Down-Regulation of a SILENT INFORMATION REGULATOR2-Related Histone Deacetylase Gene, OsSRT1,Induces DNA Fragmentation and Cell Death in RiceRice1.
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. Cite error: Invalid <ref> tag; no text was provided for refs named ref4
  5. Cite error: Invalid <ref> tag; no text was provided for refs named ref5
  6. Cite error: Invalid <ref> tag; no text was provided for refs named ref6
  7. Cite error: Invalid <ref> tag; no text was provided for refs named ref7
  8. Cite error: Invalid <ref> tag; no text was provided for refs named ref8