Difference between revisions of "Os12g0101600"

From RiceWiki
Jump to: navigation, search
(References)
 
(13 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please cite: 李志涛 (2014) Gene: "Os12g0101600" in RiceWiki, available at http://ricewiki.big.ac.cn/index.php?title=Os12g0101600&action=edit&redlink=1
+
 
 
==Annotated Information==
 
==Annotated Information==
 +
narrow leaf2 narrow leaf3 (nal2 nal3; hereafter nal2/3) double mutant produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2/3double mutant was named for its phenotype: the production of narrow leaf blades throughout development. These loci were also termed curly leaf2 (cul2) andcul3, respectively, in the GRAMENE database (http://www.gramene.org/) because the leaf blades exhibited both narrow and curly phenotypes. The singlenal2ornal3mutants did not show any defect in leaf morphology. Compared with the parental wildtype cv ‘Kinmaze’, the widths of leaf blades innal2/3were consistently narrow from early seedling to fully mature stages (Fig. 1a,b; Table S2). In addition, the nal2/3 leaves curled upward(Fig. 1b). The number of large veins (LVs) in the leaf blades wasslightly reduced to c. 80% of wild-type (Fig. 1c; Table S2), and the number of small veins (SVs) between adjacent LVs was
 +
remarkably reduced to almost a half of wild-type. The number of SVs between LVs was quite irregular in each leaf blade, and the vein distribution on the left and right side of the midrib was different. Sawtooth hairs at the leaf margins were significantly reduced (Fig. 1d). Ligule, auricle, leaf sheath and stems were also
 +
narrower and thinner (Fig. 1e,f; Table S2). Despite the reduction in leaf width, the lengths of leaf blades and leaf sheaths, and plant height were similar to wild-type (Table S2). These results indicate that NAL2/3function is mainly associated with vein patterning during leaf development and lateral-axis expansion during shoot organogenesis
 
===Function===
 
===Function===
 
Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots.
 
Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots.
Line 16: Line 19:
 
===Mutation===
 
===Mutation===
 
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.
 
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.
==Structured Information==
+
 
LOCUS      NM_001073722            1508 bp    mRNA    linear  PLN 08-JUN-2010
+
=== Knowledge Extension ===
DEFINITION  Oryza sativa Japonica Group Os12g0597000 (Os12g0597000) mRNA,
+
map-based cloning to identifyNAL2and NAL3on chromosomes 11 and 12, respectively. They encode an identical OsWOX3A/OsNS protein that is homologous to NS of
            complete cds.
+
maize and PRS of Arabidopsis, all of which belong to the same WOX3subfamily (Figs S5b, S6; Zhang et al., 2007). Both NS andPRSplay an important role in the recruitment of founder cells for margin development of lateral organ primordia in monocots and eudicots, respectively (Nardmann et al., 2004). However, the functions ofNS/PRShomologues in other plant species remain unknown. Our histological and molecular studies show that in rice, OsWOX3Ais involved in differentiation of lemma and palea in spikelets, and tiller and LR production, in addition to lateral-axis expansion in leaves.
ACCESSION  NM_001073722
+
Recently,OsWOX3B/DEP, a homologue of OsWOX3A, has been reported to regulate the formation of bristle-type trichomes in the leaves and glumes (Angeles-Shim et al., 2012). Although they belong to the same subfamily of OsWOX proteins (Fig. S6), the biological function of OsWOX3B/DEP was considerably different from that of OsWOX3A, suggesting that riceWOX3genes within the same subfamily may have diversified to have separate biological functions.  
VERSION    NM_001073722.2  GI:297613475
+
== Labs working on this gene ==
KEYWORDS    RefSeq.
+
*Department of Plant Science, Plant Genomics and Breeding Institute, Research Institute for Agriculture and Life Sciences, Seoul National University, Seoul, 151-921, Korea;Department of Molecular Biotechnology, Dong-A University, Busan, 604-714, Korea
SOURCE      Oryza sativa Japonica Group (Japanese rice)
+
 
  ORGANISM  Oryza sativa Japonica Group
+
== References ==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
* Sung-Hwan Cho;Soo-Cheul Yoo;Haitao Zhang;Devendra Pandeya;Hee-Jong Koh;Ji-Young Hwang;Gyung-Tae Kim;Nam-Chon Paek.The rice narrow leaf2 and narrow leaf3 loci encode WUSCHEL-related homeobox 3A (OsWOX3A) and function in leaf, spikelet, tiller and lateral root development New Phytologist, 2013, 198(4): 1071-1084
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
*Angeles-Shim RB, Asano K, Takashi T, Shim J, Kuroha T, Ayano M, Ashikari M. 2012.A WUSCHEL-related homeobox 3B gene,depilous(dep), confersglabrousness of rice leaves and glumes.Rice5: 28.  
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
*Chen Y, Fan X, Song W, Zhang Y, Xu G. 2012.Over-expression ofOsPIN2 leads to increased tiller numbers, angle and shorter plant height through suppression ofOsLAZY1.Plant Biotechnology Journal10: 139–149
REFERENCE  1
+
*Dai M, Hu Y, Zhao Y, Liu H, Zhou DX. 2007.AWUSCHEL-LIKE HOMEOBOXgene represses aYABBYgene expression required for rice leaf development.Plant Physiology144: 380–390
  AUTHORS  Tanaka,T., Antonio,B.A., Kikuchi,S., Matsumoto,T., Nagamura,Y.,
+
*Zhang X, Madi S, Borsuk L, Nettleton D, Elshire RJ, Buckner B, JanickBuckner D, Beck J, Timmermans M, Schnable PSet al.2007.Laser microdissection of narrow sheath mutant maize uncovers novel gene expression in the shoot apical meristem.PLoS Genetics3: 1040–1052.
            Numa,H., Sakai,H., Wu,J., Itoh,T., Sasaki,T., Aono,R., Fujii,Y.,
 
            Habara,T., Harada,E., Kanno,M., Kawahara,Y., Kawashima,H.,
 
            Kubooka,H., Matsuya,A., Nakaoka,H., Saichi,N., Sanbonmatsu,R.,
 
            Sato,Y., Shinso,Y., Suzuki,M., Takeda,J., Tanino,M., Todokoro,F.,
 
            Yamaguchi,K., Yamamoto,N., Yamasaki,C., Imanishi,T., Okido,T.,
 
            Tada,M., Ikeo,K., Tateno,Y., Gojobori,T., Lin,Y.C., Wei,F.J.,
 
            Hsing,Y.I., Zhao,Q., Han,B., Kramer,M.R., McCombie,R.W.,
 
            Lonsdale,D., O'Donovan,C.C., Whitfield,E.J., Apweiler,R.,
 
            Koyanagi,K.O., Khurana,J.P., Raghuvanshi,S., Singh,N.K.,
 
            Tyagi,A.K., Haberer,G., Fujisawa,M., Hosokawa,S., Ito,Y., Ikawa,H.,
 
            Shibata,M., Yamamoto,M., Bruskiewich,R.M., Hoen,D.R., Bureau,T.E.,
 
            Namiki,N., Ohyanagi,H., Sakai,Y., Nobushima,S., Sakata,K.,
 
            Barrero,R.A., Sato,Y., Souvorov,A., Smith-White,B., Tatusova,T.,
 
            An,S., An,G., OOta,S., Fuks,G., Fuks,G., Messing,J., Christie,K.R.,
 
            Lieberherr,D., Kim,H., Zuccolo,A., Wing,R.A., Nobuta,K.,
 
            Green,P.J., Lu,C., Meyers,B.C., Chaparro,C., Piegu,B., Panaud,O.
 
            and Echeverria,M.
 
  CONSRTM  Rice Annotation Project
 
  TITLE    The Rice Annotation Project Database (RAP-DB): 2008 update
 
  JOURNAL  Nucleic Acids Res. 36 (DATABASE ISSUE), D1028-D1033 (2008)
 
  PUBMED  18089549
 
REFERENCE  2
 
  AUTHORS  Itoh,T., Tanaka,T., Barrero,R.A., Yamasaki,C., Fujii,Y.,
 
            Hilton,P.B., Antonio,B.A., Aono,H., Apweiler,R., Bruskiewich,R.,
 
            Bureau,T., Burr,F., Costa de Oliveira,A., Fuks,G., Habara,T.,
 
            Haberer,G., Han,B., Harada,E., Hiraki,A.T., Hirochika,H., Hoen,D.,
 
            Hokari,H., Hosokawa,S., Hsing,Y.I., Ikawa,H., Ikeo,K., Imanishi,T.,
 
            Ito,Y., Jaiswal,P., Kanno,M., Kawahara,Y., Kawamura,T.,
 
            Kawashima,H., Khurana,J.P., Kikuchi,S., Komatsu,S., Koyanagi,K.O.,
 
            Kubooka,H., Lieberherr,D., Lin,Y.C., Lonsdale,D., Matsumoto,T.,
 
            Matsuya,A., McCombie,W.R., Messing,J., Miyao,A., Mulder,N.,
 
            Nagamura,Y., Nam,J., Namiki,N., Numa,H., Nurimoto,S., O'Donovan,C.,
 
            Ohyanagi,H., Okido,T., Oota,S., Osato,N., Palmer,L.E., Quetier,F.,
 
            Raghuvanshi,S., Saichi,N., Sakai,H., Sakai,Y., Sakata,K.,
 
            Sakurai,T., Sato,F., Sato,Y., Schoof,H., Seki,M., Shibata,M.,
 
            Shimizu,Y., Shinozaki,K., Shinso,Y., Singh,N.K., Smith-White,B.,
 
            Takeda,J., Tanino,M., Tatusova,T., Thongjuea,S., Todokoro,F.,
 
            Tsugane,M., Tyagi,A.K., Vanavichit,A., Wang,A., Wing,R.A.,
 
            Yamaguchi,K., Yamamoto,M., Yamamoto,N., Yu,Y., Zhang,H., Zhao,Q.,
 
            Higo,K., Burr,B., Gojobori,T. and Sasaki,T.
 
  CONSRTM  Rice Annotation Project
 
  TITLE    Curated genome annotation of Oryza sativa ssp. japonica and
 
            comparative genome analysis with Arabidopsis thaliana
 
  JOURNAL  Genome Res. 17 (2), 175-183 (2007)
 
  PUBMED  17210932
 
REFERENCE  3
 
  AUTHORS  Ohyanagi,H., Tanaka,T., Sakai,H., Shigemoto,Y., Yamaguchi,K.,
 
            Habara,T., Fujii,Y., Antonio,B.A., Nagamura,Y., Imanishi,T.,
 
            Ikeo,K., Itoh,T., Gojobori,T. and Sasaki,T.
 
  TITLE    The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa
 
            ssp. japonica genome information
 
  JOURNAL  Nucleic Acids Res. 34 (DATABASE ISSUE), D741-D744 (2006)
 
  PUBMED  16381971
 
REFERENCE  4
 
  AUTHORS  Matsumoto,T., Wu,J., Kanamori,H., Katayose,Y., Fujisawa,M.,
 
            Namiki,N., Mizuno,H., Yamamoto,K., Antonio,B.A., Baba,T.,
 
            Sakata,K., Nagamura,Y., Aoki,H., Arikawa,K., Arita,K., Bito,T.,
 
            Chiden,Y., Fujitsuka,N., Fukunaka,R., Hamada,M., Harada,C.,
 
            Hayashi,A., Hijishita,S., Honda,M., Hosokawa,S., Ichikawa,Y.,
 
            Idonuma,A., Iijima,M., Ikeda,M., Ikeno,M., Ito,K., Ito,S., Ito,T.,
 
            Ito,Y., Ito,Y., Iwabuchi,A., Kamiya,K., Karasawa,W., Kurita,K.,
 
            Katagiri,S., Kikuta,A., Kobayashi,H., Kobayashi,N., Machita,K.,
 
            Maehara,T., Masukawa,M., Mizubayashi,T., Mukai,Y., Nagasaki,H.,
 
            Nagata,Y., Naito,S., Nakashima,M., Nakama,Y., Nakamichi,Y.,
 
            Nakamura,M., Meguro,A., Negishi,M., Ohta,I., Ohta,T., Okamoto,M.,
 
            Ono,N., Saji,S., Sakaguchi,M., Sakai,K., Shibata,M., Shimokawa,T.,
 
            Song,J., Takazaki,Y., Terasawa,K., Tsugane,M., Tsuji,K., Ueda,S.,
 
            Waki,K., Yamagata,H., Yamamoto,M., Yamamoto,S., Yamane,H.,
 
            Yoshiki,S., Yoshihara,R., Yukawa,K., Zhong,H., Yano,M., Yuan,Q.,
 
            Ouyang,S., Liu,J., Jones,K.M., Gansberger,K., Moffat,K., Hill,J.,
 
            Bera,J., Fadrosh,D., Jin,S., Johri,S., Kim,M., Overton,L.,
 
            Reardon,M., Tsitrin,T., Vuong,H., Weaver,B., Ciecko,A., Tallon,L.,
 
            Jackson,J., Pai,G., Aken,S.V., Utterback,T., Reidmuller,S.,
 
            Feldblyum,T., Hsiao,J., Zismann,V., Iobst,S., de Vazeille,A.R.,
 
            Buell,C.R., Ying,K., Li,Y., Lu,T., Huang,Y., Zhao,Q., Feng,Q.,
 
            Zhang,L., Zhu,J., Weng,Q., Mu,J., Lu,Y., Fan,D., Liu,Y., Guan,J.,
 
            Zhang,Y., Yu,S., Liu,X., Zhang,Y., Hong,G., Han,B., Choisne,N.,
 
            Demange,N., Orjeda,G., Samain,S., Cattolico,L., Pelletier,E.,
 
            Couloux,A., Segurens,B., Wincker,P., D'Hont,A., Scarpelli,C.,
 
            Weissenbach,J., Salanoubat,M., Quetier,F., Yu,Y., Kim,H.R.,
 
            Rambo,T., Currie,J., Collura,K., Luo,M., Yang,T., Ammiraju,J.S.S.,
 
            Engler,F., Soderlund,C., Wing,R.A., Palmer,L.E., de la Bastide,M.,
 
            Spiegel,L., Nascimento,L., Zutavern,T., O'Shaughnessy,A., Dike,S.,
 
            Dedhia,N., Preston,R., Balija,V., McCombie,W.R., Chow,T., Chen,H.,
 
            Chung,M., Chen,C., Shaw,J., Wu,H., Hsiao,K., Chao,Y., Chu,M.,
 
            Cheng,C., Hour,A., Lee,P., Lin,S., Lin,Y., Liou,J., Liu,S.,
 
            Hsing,Y., Raghuvanshi,S., Mohanty,A., Bharti,A.K., Gaur,A.,
 
            Gupta,V., Kumar,D., Ravi,V., Vij,S., Kapur,A., Khurana,P.,
 
            Khurana,P., Khurana,J.P., Tyagi,A.K., Gaikwad,K., Singh,A.,
 
            Dalal,V., Srivastava,S., Dixit,A., Pal,A.K., Ghazi,I.A., Yadav,M.,
 
            Pandit,A., Bhargava,A., Sureshbabu,K., Batra,K., Sharma,T.R.,
 
            Mohapatra,T., Singh,N.K., Messing,J., Nelson,A.B., Fuks,G.,
 
            Kavchok,S., Keizer,G., Linton,E., Llaca,V., Song,R., Tanyolac,B.,
 
            Young,S., Ho-Il,K., Hahn,J.H., Sangsakoo,G., Vanavichit,A., de
 
            Mattos,Luiz.A.T., Zimmer,P.D., Malone,G., Dellagostin,O., de
 
            Oliveira,A.C., Bevan,M., Bancroft,I., Minx,P., Cordum,H.,
 
            Wilson,R., Cheng,Z., Jin,W., Jiang,J., Leong,S.A., Iwama,H.,
 
            Gojobori,T., Itoh,T., Niimura,Y., Fujii,Y., Habara,T., Sakai,H.,
 
            Sato,Y., Wilson,G., Kumar,K., McCouch,S., Juretic,N., Hoen,D.,
 
            Wright,S., Bruskiewich,R., Bureau,T., Miyao,A., Hirochika,H.,
 
            Nishikawa,T., Kadowaki,K., Sugiura,M., Burr,B. and Sasaki,T.
 
  CONSRTM  International Rice Genome Sequencing Project
 
  TITLE    The map-based sequence of the rice genome
 
  JOURNAL  Nature 436 (7052), 793-800 (2005)
 
  PUBMED  16100779
 
REFERENCE  5
 
  CONSRTM  IRGSP(International Rice Genome Sequencing Project)
 
  TITLE    Oryza sativa nipponbare(GA3) genomic DNA, chromosome 12
 
  JOURNAL  Unpublished
 
REFERENCE  6
 
  CONSRTM  The Rice Annotation Project (RAP)
 
  TITLE    The Second Rice Annotation Project Meeting (RAP2)
 
  JOURNAL  Unpublished
 
REFERENCE  7  (bases 1 to 1508)
 
  AUTHORS  Sasaki,T.
 
  TITLE    Direct Submission
 
  JOURNAL  Submitted (25-OCT-2004) Contact:Takuji Sasaki National Institute of
 
            Agrobiological Sciences, Rice Genome Research Program; Kannondai
 
            2-1-2, Tsukuba, Ibaraki 305-8602, Japan URL
 
            :http://rgp.dna.affrc.go.jp/
 
COMMENT    PROVISIONAL REFSEQ: This record has not yet been subject to final
 
            NCBI review. This record is derived from an annotated genomic
 
            sequence (NC_008405).
 
            On Jun 7, 2010 this sequence version replaced gi:115489405.
 
            The IRGSP pseudomolecules (Build 4.0).
 
            The orientation of the sequence is the short arm to the long arm of
 
            the chromosome.
 
            Genoscope, Evry cedex, France, URL:http://www.genoscope.cns.fr/,
 
            Tel:(33)0 1 60 87 25 00 Fax:(33)0 1 60 87 25 14
 
           
 
            The position of gaps in this pseudomolecule with unknown size is
 
            assigned 100 Ns based on the guideline set by DDBJ/EMBL/GenBank.
 
           
 
            This sequence entry was annotated by the Rice Annotation Project.
 
            http://rapdb.lab.nig.ac.jp/
 
FEATURES            Location/Qualifiers
 
    source          1..1508
 
                    /organism="Oryza sativa Japonica Group"
 
                    /mol_type="mRNA"
 
                    /cultivar="Nipponbare"
 
                    /db_xref="taxon:39947"
 
                    /chromosome="12"
 
    gene            1..1508
 
                    /gene="Os12g0597000"
 
                    /db_xref="GeneID:4352701"
 
    CDS            373..1050
 
                    /gene="Os12g0597000"
 
                    /note="Similar to Calcineurin B-like protein 2 (SOS3-like
 
                    calcium binding protein 1);
 
                    contains InterPro domain(s): IPR002048, IPR001125;
 
                    has GO asignment(s): GO:0005509;
 
                    supported by AK111887"
 
                    /codon_start=1
 
                    /product="hypothetical protein"
 
                    /protein_id="NP_001067190.1"
 
                    /db_xref="GI:115489406"
 
                    /db_xref="GeneID:4352701"
 
                    /translation="MVQCLDGVRQLLAVVFKCCDLELKQPRGLEDPQVLARETVFSVS
 
                    EVEALYELFKKISSAVIDDGLINKEEFQLALFKTSKKESLFADRVFDLFDTKHNGILG
 
                    FDEFARALSVFHPSAPLDEKIDFSFQLYDLKQQGYIERQEVKQMVVATLAESGMNLSD
 
                    EIIESIIDKTFEEADTKHDGRIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVF
 
                    HSQVDDT"
 
ORIGIN     
 
        1 agacgcacgc gcacacgcat acgcatcgca gccagttcat cctcgattcc tcccccgaat
 
      61 ttccttcgcg atctcacccc gcgtgcccta gctagctatc gaatcccgtc acctcggcgg
 
      121 cggcggcgag atcggagctc cgggttaacc tcatccaccg cgaggcgtgg aacctctctc
 
      181 tctctcgctc tcaccacctg aggatcgaag atcgaaaccc ctggcaccgg ctcgggccgc
 
      241 ggaatgggcg gccgcggtga gtagctaggt ctgcggcggc ggagttgttg ttgttggtgg
 
      301 tggtggtggt ggaggaggag ttggcggcgg agggggcggg ggcgttggtg gtggtggtgg
 
      361 tgggagagta tcatggtgca gtgtctcgac ggggtgaggc agctgctggc ggtcgtgttc
 
      421 aagtgctgcg acctcgagct gaagcagccg cgggggctcg aggatcccca ggtcctcgcg
 
      481 agggagaccg tcttcagcgt gagcgaggtc gaggcgctgt acgagctctt caagaagata
 
      541 agcagtgctg tgattgatga cgggctgatt aacaaggagg agtttcagtt ggcgctgttc
 
      601 aagaccagca agaaggagag cctgttcgcc gaccgtgtat ttgatttgtt tgacacaaaa
 
      661 cacaatggaa ttttaggatt tgatgaattt gctcgtgcac tctcagtatt tcatccaagt
 
      721 gctccacttg atgagaagat tgacttttca ttccagttat atgatctcaa gcaacaaggc
 
      781 tatattgaga gacaagaggt taagcagatg gttgttgcta cacttgctga gtctggaatg
 
      841 aatctttctg atgaaattat agagagcata atcgataaga catttgagga ggcagacaca
 
      901 aagcatgatg gaagaattga taaagaagag tggcgcaatc tggttcttcg tcatccctct
 
      961 ttgctgaaga acatgactct ccagtacctc aaggacatca ccactacatt tccaagcttt
 
    1021 gtcttccatt cccaggtcga tgacacctga attcttggat ttgtttgaac tcaaaccatc
 
    1081 agaagaatgc tcatgccggt tcattaagaa ttttgatatt gggttgttgg attgggcaga
 
    1141 gactccagag ctctgtagga tgttgcatgt tcgatttgag aagttctcaa atctttaaat
 
    1201 tgatgtaact ttgtttcttt cgtttggaag tttagtgtgg ctggagactt tcggggagat
 
    1261 gttaaatttc tgtctgaatc cgtagatcct ttattctctt cccctctttt ctgtttttct
 
    1321 ggctagcaat cagaatatct tttctgtttt tttggctagc aatcagaata tcggatatag
 
    1381 ttttgtgaat ctttcatttt gcgtacaaaa taggaacctt caaaaaaatt gatcgtgctg
 
    1441 gaaaatgttc tgttggagtt tgcaaattgc aatgatcatg aaatgctctc cttttttgag
 
    1501 agtttgca
 

Latest revision as of 13:22, 31 May 2014

Annotated Information

narrow leaf2 narrow leaf3 (nal2 nal3; hereafter nal2/3) double mutant produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2/3double mutant was named for its phenotype: the production of narrow leaf blades throughout development. These loci were also termed curly leaf2 (cul2) andcul3, respectively, in the GRAMENE database (http://www.gramene.org/) because the leaf blades exhibited both narrow and curly phenotypes. The singlenal2ornal3mutants did not show any defect in leaf morphology. Compared with the parental wildtype cv ‘Kinmaze’, the widths of leaf blades innal2/3were consistently narrow from early seedling to fully mature stages (Fig. 1a,b; Table S2). In addition, the nal2/3 leaves curled upward(Fig. 1b). The number of large veins (LVs) in the leaf blades wasslightly reduced to c. 80% of wild-type (Fig. 1c; Table S2), and the number of small veins (SVs) between adjacent LVs was remarkably reduced to almost a half of wild-type. The number of SVs between LVs was quite irregular in each leaf blade, and the vein distribution on the left and right side of the midrib was different. Sawtooth hairs at the leaf margins were significantly reduced (Fig. 1d). Ligule, auricle, leaf sheath and stems were also narrower and thinner (Fig. 1e,f; Table S2). Despite the reduction in leaf width, the lengths of leaf blades and leaf sheaths, and plant height were similar to wild-type (Table S2). These results indicate that NAL2/3function is mainly associated with vein patterning during leaf development and lateral-axis expansion during shoot organogenesis

Function

Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots. Please input function information here.

Expression

The ricenarrow leaf2andnarrow leaf3loci encode WUSCHELrelated homeobox 3A (OsWOX3A) and function in leaf, spikelet,tiller and lateral root development.nal2/3 mutation negatively affects both vegetative and reproductive organ development with a severe loss of grain yield. Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) athere

Mutation

narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.

Knowledge Extension

map-based cloning to identifyNAL2and NAL3on chromosomes 11 and 12, respectively. They encode an identical OsWOX3A/OsNS protein that is homologous to NS of maize and PRS of Arabidopsis, all of which belong to the same WOX3subfamily (Figs S5b, S6; Zhang et al., 2007). Both NS andPRSplay an important role in the recruitment of founder cells for margin development of lateral organ primordia in monocots and eudicots, respectively (Nardmann et al., 2004). However, the functions ofNS/PRShomologues in other plant species remain unknown. Our histological and molecular studies show that in rice, OsWOX3Ais involved in differentiation of lemma and palea in spikelets, and tiller and LR production, in addition to lateral-axis expansion in leaves. Recently,OsWOX3B/DEP, a homologue of OsWOX3A, has been reported to regulate the formation of bristle-type trichomes in the leaves and glumes (Angeles-Shim et al., 2012). Although they belong to the same subfamily of OsWOX proteins (Fig. S6), the biological function of OsWOX3B/DEP was considerably different from that of OsWOX3A, suggesting that riceWOX3genes within the same subfamily may have diversified to have separate biological functions.

Labs working on this gene

  • Department of Plant Science, Plant Genomics and Breeding Institute, Research Institute for Agriculture and Life Sciences, Seoul National University, Seoul, 151-921, Korea;Department of Molecular Biotechnology, Dong-A University, Busan, 604-714, Korea

References

  • Sung-Hwan Cho;Soo-Cheul Yoo;Haitao Zhang;Devendra Pandeya;Hee-Jong Koh;Ji-Young Hwang;Gyung-Tae Kim;Nam-Chon Paek.The rice narrow leaf2 and narrow leaf3 loci encode WUSCHEL-related homeobox 3A (OsWOX3A) and function in leaf, spikelet, tiller and lateral root development New Phytologist, 2013, 198(4): 1071-1084
  • Angeles-Shim RB, Asano K, Takashi T, Shim J, Kuroha T, Ayano M, Ashikari M. 2012.A WUSCHEL-related homeobox 3B gene,depilous(dep), confersglabrousness of rice leaves and glumes.Rice5: 28.
  • Chen Y, Fan X, Song W, Zhang Y, Xu G. 2012.Over-expression ofOsPIN2 leads to increased tiller numbers, angle and shorter plant height through suppression ofOsLAZY1.Plant Biotechnology Journal10: 139–149
  • Dai M, Hu Y, Zhao Y, Liu H, Zhou DX. 2007.AWUSCHEL-LIKE HOMEOBOXgene represses aYABBYgene expression required for rice leaf development.Plant Physiology144: 380–390
  • Zhang X, Madi S, Borsuk L, Nettleton D, Elshire RJ, Buckner B, JanickBuckner D, Beck J, Timmermans M, Schnable PSet al.2007.Laser microdissection of narrow sheath mutant maize uncovers novel gene expression in the shoot apical meristem.PLoS Genetics3: 1040–1052.