Difference between revisions of "Os05g0341600"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Annotated Information)
Line 4: Line 4:
 
the rice gene '''Os05g0341600''' was recongized as '''RAB 21''' in 1988, which is induced to balance water-stress of plants. encoding a basic, glycine-rich protein (mol.wt 16 529) which has a duplicated domain structure. Immunoblots probed with antibodies raised against Bgalactosidase/RAB 21 fusion protein detect RAB 21 protein only in cytosolic cell fractions. <ref name="ref1" />
 
the rice gene '''Os05g0341600''' was recongized as '''RAB 21''' in 1988, which is induced to balance water-stress of plants. encoding a basic, glycine-rich protein (mol.wt 16 529) which has a duplicated domain structure. Immunoblots probed with antibodies raised against Bgalactosidase/RAB 21 fusion protein detect RAB 21 protein only in cytosolic cell fractions. <ref name="ref1" />
 
===Expression===
 
===Expression===
RAB 21 mRNA and protein accumulate in rice embryos, leaves, roots and callus-derived suspension cells upon treatment with NaCl (200 mM) and/or the plant hormone abscisic acid (10 /tMABA). The effects of NaCI and ABA are not cumulative, suggesting that these two inducers share a common response pathway. Induction of RAB 21 mRNA accumulation by ABA is rapid (< 15 min in suspension cells) and does not require protein synthesis, indicating that preformed nuclear and/or cytosolic factors mediate the response to this hormone. We have characterized the RAB 21 gene by deternmining the complete nucleotide sequence of a nearly full-length cDNA and corresponding genomiccopy, and by mapping the start site of its major transcript. The proximal promoter region contains various GC-rich repeats.[[File:12343.jpg]]
+
RAB 21 mRNA and protein accumulate in rice embryos, leaves, roots and callus-derived suspension cells upon treatment with NaCl (200 mM) and/or the plant hormone abscisic acid (10 /tMABA). The effects of NaCI and ABA are not cumulative, suggesting that these two inducers share a common response pathway. Induction of RAB 21 mRNA accumulation by ABA is rapid (< 15 min in suspension cells) and does not require protein synthesis, indicating that preformed nuclear and/or cytosolic factors mediate the response to this hormone. We have characterized the RAB 21 gene by deternmining the complete nucleotide sequence of a nearly full-length cDNA and corresponding genomiccopy, and by mapping the start site of its major transcript. The proximal promoter region contains various GC-rich repeats.[[File:12343.png]]
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  

Revision as of 08:19, 1 June 2014

the rice gene Os05g0341600 was recongized as RAB 21 in 1988, which is induced when plants are subject to water-stress.

Annotated Information

Function

the rice gene Os05g0341600 was recongized as RAB 21 in 1988, which is induced to balance water-stress of plants. encoding a basic, glycine-rich protein (mol.wt 16 529) which has a duplicated domain structure. Immunoblots probed with antibodies raised against Bgalactosidase/RAB 21 fusion protein detect RAB 21 protein only in cytosolic cell fractions. [1]

Expression

RAB 21 mRNA and protein accumulate in rice embryos, leaves, roots and callus-derived suspension cells upon treatment with NaCl (200 mM) and/or the plant hormone abscisic acid (10 /tMABA). The effects of NaCI and ABA are not cumulative, suggesting that these two inducers share a common response pathway. Induction of RAB 21 mRNA accumulation by ABA is rapid (< 15 min in suspension cells) and does not require protein synthesis, indicating that preformed nuclear and/or cytosolic factors mediate the response to this hormone. We have characterized the RAB 21 gene by deternmining the complete nucleotide sequence of a nearly full-length cDNA and corresponding genomiccopy, and by mapping the start site of its major transcript. The proximal promoter region contains various GC-rich repeats.12343.png You can also add sub-section(s) at will.

Labs working on this gene

Laboratory of Plant Molecular Biology, Rockefeller University, 1230 York Avenue, New York, NY 10021, USA

References

  1. Mundy, J. and N.-H. Chua (1988). "Abscisic acid and water-stress induce the expression of a novel rice gene." The EMBO Journal 7(8): 2279.

Structured Information

Gene Name

Os05g0341600

Description

Similar to Ras-related protein Rab-21

Version

NM_001061782.1 GI:115463294 GeneID:4338469

Length

4497 bp

Definition

Oryza sativa Japonica Group Os05g0341600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:15997018..16001514

Sequence Coding Region

15997421..15997539,15998086..15998174,15998470..15998635,15998717..15998777,15999640..15999776
,16001320..16001386

Expression

GEO Profiles:Os05g0341600

Genome Context

<gbrowseImage1> name=NC_008398:15997018..16001514 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:15997018..16001514 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgggctcgaagccgccgccgccgccgcagcccagcgtctccttcaagctcgtcctcctcggcgacgggagagtaggcaaaacatctcttgtgctgcggtatgtgaatgatgtcttctcagacaaacaggaagcaactgttcaagcttcatatttgacaaagcgccttgttgttgaaggtgtgcctattacgctctctatctgggatacagctggacaagagaagttccatgcactaggccctatatactatcgtgatgcagacgctgctcttttagtatatgacatcacagacaatgatacttttcttcgtgtcacaaagtgggtgaaagagcttaagcaaatggcaaataaagatattgttatggccattgcagcaaataaaagtgacctggttagatcaaaacacatagacactaatgaagcagcaagctatgcagaaagtattggggcaactctctttgttacttctgccaaagctggtactgggattgatgatatcttcagtgacatagccaagagattattagagagaagaaaaaacagctccgatggcttgtcactggctcatccaaagaaaggcattttaatcgtcgacgatgaacctgagaaagaacctccaccaaagtgctgctcatag</cdnaseq>

Protein Sequence

<aaseq>MGSKPPPPPQPSVSFKLVLLGDGRVGKTSLVLRYVNDVFSDKQE ATVQASYLTKRLVVEGVPITLSIWDTAGQEKFHALGPIYYRDADAALLVYDITDNDTF LRVTKWVKELKQMANKDIVMAIAANKSDLVRSKHIDTNEAASYAESIGATLFVTSAKA GTGIDDIFSDIAKRLLERRKNSSDGLSLAHPKKGILIVDDEPEKEPPPKCCS</aaseq>

Gene Sequence

<dnaseqindica>3976..4094#3341..3429#2880..3045#2738..2798#1739..1875#129..195#tcccacacttctcctctctgaccacagcacacacgcaacaccgggacgggcgatccggaaggttctggaaccttctagaggctcgtaggagcctccggcggaacccctctcgcctcgcctcgcctccgatgggctcgaagccgccgccgccgccgcagcccagcgtctccttcaagctcgtcctcctcggcgacggtacggctatctccctctcccttccgatcccgcgaaccctcctcccccccttctcaacccccttttctgccgaattcccgatccttcagtttggggttggcgtgcgcaagaaaatagccacggaatctgggtgaattttggctgctcttgtggtgcgtgctgagccctagctagggttaggggaaagccgcagaatcatttgatctggtaccctgtgtaggtagctaaatctatagcttagacgagggagttgagcggttttgagctaagcttaccttttacttgattgccttcgaggcttagcggagtccaggagatgattagaccgagagggctactcatagaaacaatctaacaagtagaagcatattcgttcttatatagaagatttgtctagtgctagctgcagcggggactgctgcaaattcatgtggacacaaagtggcagctgaagggtggccatggagctggtggcagggaattcgtcttatgcaataggggtggataatatttcattttgatccgtgctctctgtccgcttttaagcttggattgtaatgtccagctgatctagttctatattaattggtggttttacttttcttgtcattaccttaaccaacccttgaaggcagggtcctagaaaaaaaaaattcagtatgactcagctttttggtcatctgtgtatgatgccatgggtcttacccatgttcctctagagaaagtgatgtgtgcctttttggaaaaatgatacagtatgtagtttgggaggagggggttttgatgggaaagtactacagtctttatttgggcatgcttcttagcaagtgcatgtaagtcatacatgggaatgtcaagagaatttttcttgaaaccaggcacgggtgggcattgatctaacatggtacacttgcttttcctagcattgttgaacattgactcattttgatttaggatcagcttacttatagcttagaagcaagcttggaaatcagtttgtgcattgccaaagcggaatcacgtttcatttgaagttggctaatttcaattttggaaaagaaaaaagttggagtagttttgaactgaggcaatgagcacaatgaaagaattttttaccacagtagacagtacttgataagtgatagcgccagcataatcaattgctgaaactctttaaccatgccttagtacttggctttacattttttgaatgaagatatatatgtgtttccatgcataaaagcattgttgatagtcttgtgggcatgtatcttataggttgggtcattagggtttgcttattgttataactttctgtcattgatttcagatttttaatggaagaggtgtttaggctgtcttgtaaccagtcctctgttggcccagcctatcaatgtgaaaactgataaacctaagtttaacttaggatgaattgatcataattatatgctccattttttcaatttcattgaaaagacatgtgattgaatacatttcatatttattaacacaaacaataacttttacttttctcttggcacagggagagtaggcaaaacatctcttgtgctgcggtatgtgaatgatgtcttctcagacaaacaggaagcaactgttcaagcttcatatttgacaaagcgccttgttgttgaaggtgtgcctattacgctctctatctgggtgcgttgtcatctctttgatttgcgataatttgttcaacattttttacctctttcattttctcttatgtcagttgcacacacttgtttgaagtaattgtttactaattttgctgttgggatgatattcaattatggtttcaaatcccacttatatgtgcccttgtatcagaaatcctagtaggagtcagaaaaggtgaaaccaacccaattttgttggattataatacgagattgggaatatttagagatatgtggacttagttcttcattaaaaaaggagtaaatttcatagaactacggatattttgacaaaactatcacagaactacagatttaaggtcaaatttatcccaaaactacagatttaaataaaactgttacatggtttgcttccattatagctaaagtccgagactctgtgtacttgaactcatgaagccaaacattagattgcttggacatgttcagctggcatacaacttgtctacaggtttcacggaaatgggaatgattaggtttattactctcctgttgattgatttgactctcattttgttgattgcctttttaatttaagtaagattttatcagtatggttgtgttcagttttttactgatgtgacggtatccttcatggaaatcttaaatctttaccagaatactgaaactagactttggtcctccttttggttagtttgtaggctttgcttgttctatcaacaaaagtatatttgctaccagtgactgccttctataactgagtaataacttatttccacgcgctggtcacttggttgtctcctttactttaagttcttcctgcaagatttttttagtatttaatttttcttggtttgcaggatacagctggacaagagaagttccatgcactaggccctatatactatcgtgatgcagacggtaatattcgtcttcttgttttgaattaaatatatcgaggtggatcactaaattcttttttatatcttttgatgactgcagctgctcttttagtatatgacatcacagacaatgatacttttcttcgtgtcacaaagtgggtgaaagagcttaagcaaatggcaaataaagatattgttatggccattgcagcaaataaaagtgacctggttagatcaaaacacatagacactaatgaagcagcaaggtattcttctttgttatcagttacaaatactacacagccaaaatatgtaatattgccctggtacttgagttagcaacttagcatcgttagtctttgagtagaacaaaagaaatatatgtgatatatactttatctgttgattaaactatttagatatatcagcatagtttcaacatataatctgcaatccttttatgattgtacagtttcttgaaaatgcgttcttttagttccatatttcctcttctctatctatttcatctaagtaatattgttactacatgtacatctccagctatgcagaaagtattggggcaactctctttgttacttctgccaaagctggtactgggattgatgatatcttcagtgacatagccaagagtaagtcttattgtgttagctattgctttcaattcatctccacatttttgccactttaacaaatactgctttgccaaaacttataagttgtaacattcagctattccattagaatgcggggtcatcaacgatagcatatagtttagttaacaatttcatgtttcactctattgagcagatttcgtttatcaaactcaattgttattcctcagattaatccattgtataacactcaatatttgcgaattccctcttcatctcaataacaaggtgggtatggacccacatgtcattggtatagaatgctgtattcgaagtggctatgttgtatgtagtttgtctagagctattcttgcaatgacataacttgcaataaatggatatgtatgcattcttaatcctactgattttctggacttgtcaccagggaattcaaacactgctaacatggaactatttatttccttttaagctgttgaaaatcgtatgtccctaactgattggtggttttcttaattgctatgccctcactaccgtttgttgtaggattattagagagaagaaaaaacagctccgatggcttgtcactggctcatccaaagaaaggcattttaatcgtcgacgatgaacctgagaaagaacctccaccaaagtgctgctcatagcgagattccaatgcaaatcacgtgggcataatgtcatagaaacctgcaattgatatgtgaaggatcaaatccttgcattaactttgctcatgctcttttggagctcaggagcaatgcaagtgtatactggttgattatttttagcttgtgtaaatactaaactcagttcatgaaattgttgtcaaatatagttgttcgatgatgacgattcgatatgccgaagaagttcatggccctttgtatatctgtaactcacaggttgcttatttactagctgttgttttgagggggttattttgatcatgtgcgtcgaaataattgtgtcgtgttgactgctgagtgtacatgtatcgtggttattccatctgaacctgcaatgtaaagcttccgtcccaattcccaa</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0341600, RefSeq:Os05g0341600