Difference between revisions of "Os11g0703900"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(References)
Line 45: Line 45:
  
 
==References==
 
==References==
Please input cited references here.
+
 
 +
[1]Ahuja I, RCH. De Vos, Bones AM, Hall RD: Plant molecular stress responses face climate change. Trends in Plant Science 2010, Vol. 15, No. 12.
 +
[2]Wang W, Vinocur B, Shoseyov O, Altman A: Role of plant heat-shock proteins and molecular chaperones in the abiotic stress response. Trends in Plant Science 2004, Vol. 9, No. 5.
 +
[3]Timperio AM, Egidi MG, Zolla L: Proteomics applied on plant abiotic stresses: Role of heat shock proteins (HSP). Journal of Proteomics 2008, 71: 391-411.
 +
[4]Sarkar N K, Kundnani P, Grover A. Functional analysis of Hsp70 superfamily proteins of rice (Oryza sativa)[J]. Cell Stress and Chaperones, 2013, 18(4): 427-437.
 +
[5] Ding  XZ,  Tsokos  GC,  Kiang  JG:  Overexpression  of  HSP-70  inhibits  the phosphorylation  of  HSF1  by  activating  protein  phosphatase  and  inhibiting protein kinase C activity. The FASEB Journal 1998, 12:451–459.
 +
[6]Shi Y, Mosser D D, Morimoto R I. Molecularchaperones as HSF1-specific transcriptional repressors[J]. Genes & development, 1998, 12(5): 654-666.
 +
[7]Kim B H, Schöffl F. Interaction between Arabidopsis heat shock transcription factor 1 and 70 kDa heat shock proteins[J]. Journal of experimental botany, 2002, 53(367): 371-375.
 +
[8]Sarkar N K, Kundnani P, Grover A. Functional analysis of Hsp70 superfamily proteins of rice (Oryza sativa)[J]. Cell Stress and Chaperones, 2013, 18(4): 427-437.
 +
[9]Muench D G, Wu Y, Zhang Y, et al. Molecular cloning, expression and subcellular localization of a BiP homolog from rice endosperm tissue[J]. Plant and cell physiology, 1997, 38(4): 404-412.
 +
[10]Snowden C J, Leborgne‐Castel N, Wootton L J, et al. In vivo analysis of the lumenal binding protein (BiP) reveals multiple functions of its ATPase domain[J]. The Plant Journal, 2007, 52(6): 987-1000.
 +
[11]Qi Y, Wang H, Zou Y, et al. Over-expression of mitochondrial heat shock protein 70 suppresses programmed cell death in rice[J]. FEBS letters, 2011, 585(1): 231-239.
 +
[12] Kim BH, Schöffl F. Interaction between Arabidopsis heat shock transcription factor 1 and 70 kDa heat shock proteins. Journal of Experimental Botany 2002, 53(367):371-375.
 +
[13]  Kiang JG, Ding XZ, McClain DE. Overexpression of HSP-70 attenuates increases in [Ca2+]I and protects human epidermoid A-431 cells after chemical hypoxia. Toxicology and Applied Pharmacology 1998, 149(2):185-194.
 +
[14]  Knight H: Calcium signaling during abiotic stress in plants. International Review of Cytology 2000, 195:269-324.
  
 
==Structured Information==
 
==Structured Information==

Revision as of 01:10, 3 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Heat shock proteins (heat shock protein, Hsp) are a class of resistance protein molecules playing an important role in the process of environmental stress[1-3].

Hsp70 genes encode for a group of highly conserved chaperone proteins across the living systems encompassing bacteria, plants, and animals[4].

Hsp70 can not only prevent proteins aggregation and help inactivated proteins refolding, but also assist the functions of transport and participate in the intracellular signal transduction, such as protein kinase C (protein kinase C, PKC) and protein phosphorylation activity (protein phosphatase)[5].

It is noted that Hsp70 may function as a negative feedback regulator of HSF activity[6-7].In this process, Hsp70 binds to denatured proteins and releases HSF leading to its activation during heat stress[6].

Expression

Rice Hsp70 superfamily genes are represented by 24 Hsp70 family and 8 Hsp110 family members[8].

In rice, ER Hsp70 (BiP) is found to associate with nascent polypeptides that emerge into the ER lumen during prolamin translocation and facilitate peptide folding and assembly[9]. Over-expression of BiP relieves "ER stress"[10].

Rice mitochondrial Hsp70 has been proposed as suppressor of heat and H2O2-induced programmed cell death[11].


Hsp70 regulates the expression of stress response genes, such as the regulation of the heat shock protein transcription factor (heat-shock factor, HSF)[5,12].


Overexpression of Hsp70 will decrease the concentration of Ca2+ intracellular[13], which usually works as a second messenger to stimulate the activity of protein kinases in downstream when the organism faces an environmental stress[14].

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

1.Sarkar N K, Kundnani P, Grover A.Department of Plant Molecular Biology, University of Delhi South Campus, N Delhi 110021, India

2.Wei ZhangCollege of Life Science, Nanjing Agricultural University, Nanjing, Jiangsu 210095, China

3.Laboratorium voor Genetica, Universiteit Gent, K.L. Ledeganckstraat 35, B-9000 Gent, Belgium

4.An Department of Plant Molecular Systems Biotechnology and Crop Biotech Institute, Kyung Hee University, Yongin 446-701, South Korea

5.Institute of Microbiology, Chinese Academy of Sciences, Beijing 100101, China

References

[1]Ahuja I, RCH. De Vos, Bones AM, Hall RD: Plant molecular stress responses face climate change. Trends in Plant Science 2010, Vol. 15, No. 12. [2]Wang W, Vinocur B, Shoseyov O, Altman A: Role of plant heat-shock proteins and molecular chaperones in the abiotic stress response. Trends in Plant Science 2004, Vol. 9, No. 5. [3]Timperio AM, Egidi MG, Zolla L: Proteomics applied on plant abiotic stresses: Role of heat shock proteins (HSP). Journal of Proteomics 2008, 71: 391-411. [4]Sarkar N K, Kundnani P, Grover A. Functional analysis of Hsp70 superfamily proteins of rice (Oryza sativa)[J]. Cell Stress and Chaperones, 2013, 18(4): 427-437. [5] Ding XZ, Tsokos GC, Kiang JG: Overexpression of HSP-70 inhibits the phosphorylation of HSF1 by activating protein phosphatase and inhibiting protein kinase C activity. The FASEB Journal 1998, 12:451–459. [6]Shi Y, Mosser D D, Morimoto R I. Molecularchaperones as HSF1-specific transcriptional repressors[J]. Genes & development, 1998, 12(5): 654-666. [7]Kim B H, Schöffl F. Interaction between Arabidopsis heat shock transcription factor 1 and 70 kDa heat shock proteins[J]. Journal of experimental botany, 2002, 53(367): 371-375. [8]Sarkar N K, Kundnani P, Grover A. Functional analysis of Hsp70 superfamily proteins of rice (Oryza sativa)[J]. Cell Stress and Chaperones, 2013, 18(4): 427-437. [9]Muench D G, Wu Y, Zhang Y, et al. Molecular cloning, expression and subcellular localization of a BiP homolog from rice endosperm tissue[J]. Plant and cell physiology, 1997, 38(4): 404-412. [10]Snowden C J, Leborgne‐Castel N, Wootton L J, et al. In vivo analysis of the lumenal binding protein (BiP) reveals multiple functions of its ATPase domain[J]. The Plant Journal, 2007, 52(6): 987-1000. [11]Qi Y, Wang H, Zou Y, et al. Over-expression of mitochondrial heat shock protein 70 suppresses programmed cell death in rice[J]. FEBS letters, 2011, 585(1): 231-239. [12] Kim BH, Schöffl F. Interaction between Arabidopsis heat shock transcription factor 1 and 70 kDa heat shock proteins. Journal of Experimental Botany 2002, 53(367):371-375. [13] Kiang JG, Ding XZ, McClain DE. Overexpression of HSP-70 attenuates increases in [Ca2+]I and protects human epidermoid A-431 cells after chemical hypoxia. Toxicology and Applied Pharmacology 1998, 149(2):185-194. [14] Knight H: Calcium signaling during abiotic stress in plants. International Review of Cytology 2000, 195:269-324.

Structured Information

Gene Name

Os11g0703900

Description

Heat shock protein 70

Version

NM_001075072.1 GI:115486792 GeneID:4351208

Length

4293 bp

Definition

Oryza sativa Japonica Group Os11g0703900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:30612818..30617110

Sequence Coding Region

30612889..30613102,30615017..30616752

Expression

GEO Profiles:Os11g0703900

Genome Context

<gbrowseImage1> name=NC_008404:30612818..30617110 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008404:30612818..30617110 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgggcaagggcgagggtccggccatcggcatcgaccttggcacgacctactcgtgcgtgggcgtttggcagcacgaccgcgtggagatcatcgccaacgaccagggcaaccgcaccaccccctcctacgtcggcttcaccgactccgagaggctcatcggagatgctgccaagaaccaggtcgccatgaaccccatcaacaccgtctttgatgccaagcgtctcattggcaggaggtttagcgatgcttctgttcagagtgacattaagctctggcccttcaaggtgattgctggacctggtgacaagcctatgattgttgtccagtacaagggtgaggagaagcagtttgctgcagaagagatctcctccatggtcctcatcaagatgcgtgagattgctgaggcctaccttggcaccaccatcaagaatgccgttgtcactgttcctgcctacttcaatgactcccagaggcaggccaccaaggatgctggagtgattgctggtctcaatgtcatgcgtatcatcaacgagccgactgctgcagctattgcctatggtcttgataagaaggccaccagcgttggtgagaagaatgtcctcatctttgaccttggaggtggtacctttgatgtctccctccttaccattgaggagggtatctttgaggtcaaggccacagctggtgacacccatcttggtggtgaagattttgacaatcgtatggtcaaccactttgtgcaagaattcaagaggaagaacaagaaggatatcactggcaaccccagggctctcaggaggttgaggacagcttgtgagagggcaaagaggaccctgtcctccactgcccagaccaccattgagatcgattccctgtatgagggcatcgacttctactcaaccatcacccgtgccaggtttgaggagctcaacatggatctcttcaggaagtgtatggagcctgtggagaagtgcctcagggatgctaagatggacaagagctctgttcatgatgttgtccttgttggtggctccactaggatcccgagggtgcagcagctcctgcaggatttcttcaacggcaaggagctttgcaagaacatcaacccagatgaggctgttgcttatggtgctgctgtccaggctgccatcttgagtggtgagggcaacgagaaggtccaggacctcctcctgttggatgttacccctctctctctcggtttggagactgctggtggtgtcatgaccgttttgatcccaaggaacaccaccattcccaccaagaaggagcaggtcttctccacctactccgacaaccagcctggtgtgctcatccaggtttatgagggtgagaggaccaggacacgtgacaacaacctgctggggaagtttgagctctctggaatccctcctgctcccaggggtgttccacagatcactgtttgcttcgacattgatgccaatggtatcctgaacgtgtctgctgaggacaagaccaccgggcagaagaacaagatcaccattaccaacgacaagggcaggcttagcaaggaggagattgagaagatggtccaggaggccgagaagtacaagtcagaggatgaggagcacaagaagaaggtggagtccaagaacgcgctggagaactacgcctacaacatgcgcaacaccatcaaggatgagaagatcgcctcgaagctcccggcagcggacaagaagaagatcgaggatgccatcgaccaggccatccagtggctggacggcaaccagctcgctgaggctgatgagttcgatgacaagatgaaggagctggagggcatctgcaaccccatcatcgccaagatgtaccagggcgctggcgcggacatggccggcggcatggacgaggacgatgctcccccggctggcggcagcggtgctggccccaagatcgaggaggtcgactaa</cdnaseq>

Protein Sequence

<aaseq>MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSY VGFTDSERLIGDAAKNQVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPG DKPMIVVQYKGEEKQFAAEEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ ATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTI EEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERA KRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDK SSVHDVVLVGGSTRIPRVQQLLQDFFNGKELCKNINPDEAVAYGAAVQAAILSGEGNE KVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYE GERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKIT ITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIKDEKIAS KLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPIIAKMYQGAGADM AGGMDEDDAPPAGGSGAGPKIEEVD</aaseq>

Gene Sequence

<dnaseqindica>72..285#2200..3935#ctctcccactcttcctcctccccaaaccctagccgccgccgccggcgtactcgagagaaacatcagcatccatggcgggcaagggcgagggtccggccatcggcatcgaccttggcacgacctactcgtgcgtgggcgtttggcagcacgaccgcgtggagatcatcgccaacgaccagggcaaccgcaccaccccctcctacgtcggcttcaccgactccgagaggctcatcggagatgctgccaagaaccaggtcgccatgaaccccatcaacaccgtctttggtaactacttattccctgctcctcagtcctctctctttctctctctccccccttagatctcatctctaaggtcttcgtcgtcgtcgtatgctagatctactcttgcccagctcgttcagatctgttagatttgtgtgggatgctctaattaattactaccaacttagtagatctggaactcttttgacttgcagatcttgctccactcctgttgcattttgaatctgtgttgatgtgatttaagttgttggcagtgctttttgcatactatttgaatttgtggatggttagcagtcagtacactaggatttattactggatctggacagatatgctcgtttcaatcggctcgatttgctatgttgatagctaacatgttgtgcttgtcctactgccctggcgcaaatttgatccatgcattcttttcgttaaatgatttgtcaagtagtaatgcttgtttgaaaatgatattattattattattattattttaaataaatatagcctgaaacattcttagtttcgaggagaagtgatgatgtcttatccataccacatgtctgcatctcatatgatgattaatctacatcatgcactaccatctgatctcctctagctcatacagcttttaacaagttaggcgatagatgtttgctacaaacagtcaactggatttgctttcttgaaagaaaaaaaatgaaccgtgtagtttgcaacctgtgatgtaaattaacccatttactgaactacattgattatttcagtaaaatcaccatctttcggctgaggttgcatgcttagttattatatttttaccaatgatgattttgttatgtagccagatactgtactttcttatgccatttggtatctgactcattgtctacttttgtgactatgtgtctcgaaatatggcatataataagggggaacggatcttgcgacattgatggctcctgtatgagcctccaattactatatagccgtttacatgttcttatcatgttacttttccaaattagtgctgcacatcttgtctgtttgcaagtttgggttcattcatattgctgtgggcattttaatacatcttaactataatgtaaatttcttgtacatcgctaaaattttctgccttgattgagtagactcttagatgacatctatcttaccttatgcacttgattcgtatttctgttacaacattttgattacttgatgtagttcacacaagcatgacacatctctttgaaaaaaagatttcattttttaaagcaagcctaatgctttagggtgggagaagtgatgatacttaatccatacaacatttctgcatctcagatgatgatcaatctacatcatgcactaccatctgatctccccatcatacaattttttattttgttttgttggattatataactttaacatttgataaagtgccaacagatttttatacacaatttcttatagatattaccatgacagcttgcagcctgtgatgcaaaagtacccattaaactgaattacactgattattccaaacaaatcaccatctttcggctgaggttgcttgcttgtttaaaattatgaatgcttcttgcacaaccatttaggactttcggtagtttgtaatgccatttggtatctgacacatggtctgcgcttgtgactatttgtcttgaaatatggcataaaacaagggggaacggatcttgcgacattggtggttcctctatgatcctccaattactatatagctgtttacaatttgttaagttaggagcataccttttgctttgtcatcaaagtcttggttcctttgtatttctagttcagattcatttttcttcagcttttgaaacataaactcagtatatttttactgtaattgctgacattgagtcttctctgcagatgccaagcgtctcattggcaggaggtttagcgatgcttctgttcagagtgacattaagctctggcccttcaaggtgattgctggacctggtgacaagcctatgattgttgtccagtacaagggtgaggagaagcagtttgctgcagaagagatctcctccatggtcctcatcaagatgcgtgagattgctgaggcctaccttggcaccaccatcaagaatgccgttgtcactgttcctgcctacttcaatgactcccagaggcaggccaccaaggatgctggagtgattgctggtctcaatgtcatgcgtatcatcaacgagccgactgctgcagctattgcctatggtcttgataagaaggccaccagcgttggtgagaagaatgtcctcatctttgaccttggaggtggtacctttgatgtctccctccttaccattgaggagggtatctttgaggtcaaggccacagctggtgacacccatcttggtggtgaagattttgacaatcgtatggtcaaccactttgtgcaagaattcaagaggaagaacaagaaggatatcactggcaaccccagggctctcaggaggttgaggacagcttgtgagagggcaaagaggaccctgtcctccactgcccagaccaccattgagatcgattccctgtatgagggcatcgacttctactcaaccatcacccgtgccaggtttgaggagctcaacatggatctcttcaggaagtgtatggagcctgtggagaagtgcctcagggatgctaagatggacaagagctctgttcatgatgttgtccttgttggtggctccactaggatcccgagggtgcagcagctcctgcaggatttcttcaacggcaaggagctttgcaagaacatcaacccagatgaggctgttgcttatggtgctgctgtccaggctgccatcttgagtggtgagggcaacgagaaggtccaggacctcctcctgttggatgttacccctctctctctcggtttggagactgctggtggtgtcatgaccgttttgatcccaaggaacaccaccattcccaccaagaaggagcaggtcttctccacctactccgacaaccagcctggtgtgctcatccaggtttatgagggtgagaggaccaggacacgtgacaacaacctgctggggaagtttgagctctctggaatccctcctgctcccaggggtgttccacagatcactgtttgcttcgacattgatgccaatggtatcctgaacgtgtctgctgaggacaagaccaccgggcagaagaacaagatcaccattaccaacgacaagggcaggcttagcaaggaggagattgagaagatggtccaggaggccgagaagtacaagtcagaggatgaggagcacaagaagaaggtggagtccaagaacgcgctggagaactacgcctacaacatgcgcaacaccatcaaggatgagaagatcgcctcgaagctcccggcagcggacaagaagaagatcgaggatgccatcgaccaggccatccagtggctggacggcaaccagctcgctgaggctgatgagttcgatgacaagatgaaggagctggagggcatctgcaaccccatcatcgccaagatgtaccagggcgctggcgcggacatggccggcggcatggacgaggacgatgctcccccggctggcggcagcggtgctggccccaagatcgaggaggtcgactaagcgcgaaatttgctagtgatccgcgcttcaagttatcttattgcattattagtgtctcttttatgttgtgttaaaaaactttgctgctatgacttatgatgatacccttggtctgtttgggcagtccttttgaattgaagaactgcgttgggagctctatgagaactatgaattgcgtgagaaatttaattattgtggtgcttgcagcgcctattatttggtctctgtcccacgtttattatttgcatgtgcgcattgtttgctagcaattgctgttgtgcttctcagccaacatgtaaactgtttggattgtttctgatttttggatgcattttttaaagcggatagtgaaggacgg</dnaseqindica>

External Link(s)

NCBI Gene:Os11g0703900, RefSeq:Os11g0703900