Difference between revisions of "Os11g0703900"
(→References) |
(→References) |
||
| Line 47: | Line 47: | ||
[1]Ahuja I, RCH. De Vos, Bones AM, Hall RD: Plant molecular stress responses face climate change. Trends in Plant Science 2010, Vol. 15, No. 12. | [1]Ahuja I, RCH. De Vos, Bones AM, Hall RD: Plant molecular stress responses face climate change. Trends in Plant Science 2010, Vol. 15, No. 12. | ||
| + | |||
[2]Wang W, Vinocur B, Shoseyov O, Altman A: Role of plant heat-shock proteins and molecular chaperones in the abiotic stress response. Trends in Plant Science 2004, Vol. 9, No. 5. | [2]Wang W, Vinocur B, Shoseyov O, Altman A: Role of plant heat-shock proteins and molecular chaperones in the abiotic stress response. Trends in Plant Science 2004, Vol. 9, No. 5. | ||
| + | |||
[3]Timperio AM, Egidi MG, Zolla L: Proteomics applied on plant abiotic stresses: Role of heat shock proteins (HSP). Journal of Proteomics 2008, 71: 391-411. | [3]Timperio AM, Egidi MG, Zolla L: Proteomics applied on plant abiotic stresses: Role of heat shock proteins (HSP). Journal of Proteomics 2008, 71: 391-411. | ||
| + | |||
[4]Sarkar N K, Kundnani P, Grover A. Functional analysis of Hsp70 superfamily proteins of rice (Oryza sativa)[J]. Cell Stress and Chaperones, 2013, 18(4): 427-437. | [4]Sarkar N K, Kundnani P, Grover A. Functional analysis of Hsp70 superfamily proteins of rice (Oryza sativa)[J]. Cell Stress and Chaperones, 2013, 18(4): 427-437. | ||
| + | |||
[5] Ding XZ, Tsokos GC, Kiang JG: Overexpression of HSP-70 inhibits the phosphorylation of HSF1 by activating protein phosphatase and inhibiting protein kinase C activity. The FASEB Journal 1998, 12:451–459. | [5] Ding XZ, Tsokos GC, Kiang JG: Overexpression of HSP-70 inhibits the phosphorylation of HSF1 by activating protein phosphatase and inhibiting protein kinase C activity. The FASEB Journal 1998, 12:451–459. | ||
| + | |||
[6]Shi Y, Mosser D D, Morimoto R I. Molecularchaperones as HSF1-specific transcriptional repressors[J]. Genes & development, 1998, 12(5): 654-666. | [6]Shi Y, Mosser D D, Morimoto R I. Molecularchaperones as HSF1-specific transcriptional repressors[J]. Genes & development, 1998, 12(5): 654-666. | ||
| + | |||
[7]Kim B H, Schöffl F. Interaction between Arabidopsis heat shock transcription factor 1 and 70 kDa heat shock proteins[J]. Journal of experimental botany, 2002, 53(367): 371-375. | [7]Kim B H, Schöffl F. Interaction between Arabidopsis heat shock transcription factor 1 and 70 kDa heat shock proteins[J]. Journal of experimental botany, 2002, 53(367): 371-375. | ||
| + | |||
[8]Sarkar N K, Kundnani P, Grover A. Functional analysis of Hsp70 superfamily proteins of rice (Oryza sativa)[J]. Cell Stress and Chaperones, 2013, 18(4): 427-437. | [8]Sarkar N K, Kundnani P, Grover A. Functional analysis of Hsp70 superfamily proteins of rice (Oryza sativa)[J]. Cell Stress and Chaperones, 2013, 18(4): 427-437. | ||
| + | |||
[9]Muench D G, Wu Y, Zhang Y, et al. Molecular cloning, expression and subcellular localization of a BiP homolog from rice endosperm tissue[J]. Plant and cell physiology, 1997, 38(4): 404-412. | [9]Muench D G, Wu Y, Zhang Y, et al. Molecular cloning, expression and subcellular localization of a BiP homolog from rice endosperm tissue[J]. Plant and cell physiology, 1997, 38(4): 404-412. | ||
| + | |||
[10]Snowden C J, Leborgne‐Castel N, Wootton L J, et al. In vivo analysis of the lumenal binding protein (BiP) reveals multiple functions of its ATPase domain[J]. The Plant Journal, 2007, 52(6): 987-1000. | [10]Snowden C J, Leborgne‐Castel N, Wootton L J, et al. In vivo analysis of the lumenal binding protein (BiP) reveals multiple functions of its ATPase domain[J]. The Plant Journal, 2007, 52(6): 987-1000. | ||
| + | |||
[11]Qi Y, Wang H, Zou Y, et al. Over-expression of mitochondrial heat shock protein 70 suppresses programmed cell death in rice[J]. FEBS letters, 2011, 585(1): 231-239. | [11]Qi Y, Wang H, Zou Y, et al. Over-expression of mitochondrial heat shock protein 70 suppresses programmed cell death in rice[J]. FEBS letters, 2011, 585(1): 231-239. | ||
| + | |||
[12] Kim BH, Schöffl F. Interaction between Arabidopsis heat shock transcription factor 1 and 70 kDa heat shock proteins. Journal of Experimental Botany 2002, 53(367):371-375. | [12] Kim BH, Schöffl F. Interaction between Arabidopsis heat shock transcription factor 1 and 70 kDa heat shock proteins. Journal of Experimental Botany 2002, 53(367):371-375. | ||
| + | |||
[13] Kiang JG, Ding XZ, McClain DE. Overexpression of HSP-70 attenuates increases in [Ca2+]I and protects human epidermoid A-431 cells after chemical hypoxia. Toxicology and Applied Pharmacology 1998, 149(2):185-194. | [13] Kiang JG, Ding XZ, McClain DE. Overexpression of HSP-70 attenuates increases in [Ca2+]I and protects human epidermoid A-431 cells after chemical hypoxia. Toxicology and Applied Pharmacology 1998, 149(2):185-194. | ||
| + | |||
[14] Knight H: Calcium signaling during abiotic stress in plants. International Review of Cytology 2000, 195:269-324. | [14] Knight H: Calcium signaling during abiotic stress in plants. International Review of Cytology 2000, 195:269-324. | ||
Revision as of 01:11, 3 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Heat shock proteins (heat shock protein, Hsp) are a class of resistance protein molecules playing an important role in the process of environmental stress[1-3].
Hsp70 genes encode for a group of highly conserved chaperone proteins across the living systems encompassing bacteria, plants, and animals[4].
Hsp70 can not only prevent proteins aggregation and help inactivated proteins refolding, but also assist the functions of transport and participate in the intracellular signal transduction, such as protein kinase C (protein kinase C, PKC) and protein phosphorylation activity (protein phosphatase)[5].
It is noted that Hsp70 may function as a negative feedback regulator of HSF activity[6-7].In this process, Hsp70 binds to denatured proteins and releases HSF leading to its activation during heat stress[6].
Expression
Rice Hsp70 superfamily genes are represented by 24 Hsp70 family and 8 Hsp110 family members[8].
In rice, ER Hsp70 (BiP) is found to associate with nascent polypeptides that emerge into the ER lumen during prolamin translocation and facilitate peptide folding and assembly[9]. Over-expression of BiP relieves "ER stress"[10].
Rice mitochondrial Hsp70 has been proposed as suppressor of heat and H2O2-induced programmed cell death[11].
Hsp70 regulates the expression of stress response genes, such as the regulation of the heat shock protein transcription factor (heat-shock factor, HSF)[5,12].
Overexpression of Hsp70 will decrease the concentration of Ca2+ intracellular[13], which usually works as a second messenger to stimulate the activity of protein kinases in downstream when the organism faces an environmental stress[14].
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
1.Sarkar N K, Kundnani P, Grover A.Department of Plant Molecular Biology, University of Delhi South Campus, N Delhi 110021, India
2.Wei ZhangCollege of Life Science, Nanjing Agricultural University, Nanjing, Jiangsu 210095, China
3.Laboratorium voor Genetica, Universiteit Gent, K.L. Ledeganckstraat 35, B-9000 Gent, Belgium
4.An Department of Plant Molecular Systems Biotechnology and Crop Biotech Institute, Kyung Hee University, Yongin 446-701, South Korea
5.Institute of Microbiology, Chinese Academy of Sciences, Beijing 100101, China
References
[1]Ahuja I, RCH. De Vos, Bones AM, Hall RD: Plant molecular stress responses face climate change. Trends in Plant Science 2010, Vol. 15, No. 12.
[2]Wang W, Vinocur B, Shoseyov O, Altman A: Role of plant heat-shock proteins and molecular chaperones in the abiotic stress response. Trends in Plant Science 2004, Vol. 9, No. 5.
[3]Timperio AM, Egidi MG, Zolla L: Proteomics applied on plant abiotic stresses: Role of heat shock proteins (HSP). Journal of Proteomics 2008, 71: 391-411.
[4]Sarkar N K, Kundnani P, Grover A. Functional analysis of Hsp70 superfamily proteins of rice (Oryza sativa)[J]. Cell Stress and Chaperones, 2013, 18(4): 427-437.
[5] Ding XZ, Tsokos GC, Kiang JG: Overexpression of HSP-70 inhibits the phosphorylation of HSF1 by activating protein phosphatase and inhibiting protein kinase C activity. The FASEB Journal 1998, 12:451–459.
[6]Shi Y, Mosser D D, Morimoto R I. Molecularchaperones as HSF1-specific transcriptional repressors[J]. Genes & development, 1998, 12(5): 654-666.
[7]Kim B H, Schöffl F. Interaction between Arabidopsis heat shock transcription factor 1 and 70 kDa heat shock proteins[J]. Journal of experimental botany, 2002, 53(367): 371-375.
[8]Sarkar N K, Kundnani P, Grover A. Functional analysis of Hsp70 superfamily proteins of rice (Oryza sativa)[J]. Cell Stress and Chaperones, 2013, 18(4): 427-437.
[9]Muench D G, Wu Y, Zhang Y, et al. Molecular cloning, expression and subcellular localization of a BiP homolog from rice endosperm tissue[J]. Plant and cell physiology, 1997, 38(4): 404-412.
[10]Snowden C J, Leborgne‐Castel N, Wootton L J, et al. In vivo analysis of the lumenal binding protein (BiP) reveals multiple functions of its ATPase domain[J]. The Plant Journal, 2007, 52(6): 987-1000.
[11]Qi Y, Wang H, Zou Y, et al. Over-expression of mitochondrial heat shock protein 70 suppresses programmed cell death in rice[J]. FEBS letters, 2011, 585(1): 231-239.
[12] Kim BH, Schöffl F. Interaction between Arabidopsis heat shock transcription factor 1 and 70 kDa heat shock proteins. Journal of Experimental Botany 2002, 53(367):371-375.
[13] Kiang JG, Ding XZ, McClain DE. Overexpression of HSP-70 attenuates increases in [Ca2+]I and protects human epidermoid A-431 cells after chemical hypoxia. Toxicology and Applied Pharmacology 1998, 149(2):185-194.
[14] Knight H: Calcium signaling during abiotic stress in plants. International Review of Cytology 2000, 195:269-324.
Structured Information
| Gene Name |
Os11g0703900 |
|---|---|
| Description |
Heat shock protein 70 |
| Version |
NM_001075072.1 GI:115486792 GeneID:4351208 |
| Length |
4293 bp |
| Definition |
Oryza sativa Japonica Group Os11g0703900, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 11:30612818..30617110 |
| Sequence Coding Region |
30612889..30613102,30615017..30616752 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008404:30612818..30617110 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008404:30612818..30617110 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcgggcaagggcgagggtccggccatcggcatcgaccttggcacgacctactcgtgcgtgggcgtttggcagcacgaccgcgtggagatcatcgccaacgaccagggcaaccgcaccaccccctcctacgtcggcttcaccgactccgagaggctcatcggagatgctgccaagaaccaggtcgccatgaaccccatcaacaccgtctttgatgccaagcgtctcattggcaggaggtttagcgatgcttctgttcagagtgacattaagctctggcccttcaaggtgattgctggacctggtgacaagcctatgattgttgtccagtacaagggtgaggagaagcagtttgctgcagaagagatctcctccatggtcctcatcaagatgcgtgagattgctgaggcctaccttggcaccaccatcaagaatgccgttgtcactgttcctgcctacttcaatgactcccagaggcaggccaccaaggatgctggagtgattgctggtctcaatgtcatgcgtatcatcaacgagccgactgctgcagctattgcctatggtcttgataagaaggccaccagcgttggtgagaagaatgtcctcatctttgaccttggaggtggtacctttgatgtctccctccttaccattgaggagggtatctttgaggtcaaggccacagctggtgacacccatcttggtggtgaagattttgacaatcgtatggtcaaccactttgtgcaagaattcaagaggaagaacaagaaggatatcactggcaaccccagggctctcaggaggttgaggacagcttgtgagagggcaaagaggaccctgtcctccactgcccagaccaccattgagatcgattccctgtatgagggcatcgacttctactcaaccatcacccgtgccaggtttgaggagctcaacatggatctcttcaggaagtgtatggagcctgtggagaagtgcctcagggatgctaagatggacaagagctctgttcatgatgttgtccttgttggtggctccactaggatcccgagggtgcagcagctcctgcaggatttcttcaacggcaaggagctttgcaagaacatcaacccagatgaggctgttgcttatggtgctgctgtccaggctgccatcttgagtggtgagggcaacgagaaggtccaggacctcctcctgttggatgttacccctctctctctcggtttggagactgctggtggtgtcatgaccgttttgatcccaaggaacaccaccattcccaccaagaaggagcaggtcttctccacctactccgacaaccagcctggtgtgctcatccaggtttatgagggtgagaggaccaggacacgtgacaacaacctgctggggaagtttgagctctctggaatccctcctgctcccaggggtgttccacagatcactgtttgcttcgacattgatgccaatggtatcctgaacgtgtctgctgaggacaagaccaccgggcagaagaacaagatcaccattaccaacgacaagggcaggcttagcaaggaggagattgagaagatggtccaggaggccgagaagtacaagtcagaggatgaggagcacaagaagaaggtggagtccaagaacgcgctggagaactacgcctacaacatgcgcaacaccatcaaggatgagaagatcgcctcgaagctcccggcagcggacaagaagaagatcgaggatgccatcgaccaggccatccagtggctggacggcaaccagctcgctgaggctgatgagttcgatgacaagatgaaggagctggagggcatctgcaaccccatcatcgccaagatgtaccagggcgctggcgcggacatggccggcggcatggacgaggacgatgctcccccggctggcggcagcggtgctggccccaagatcgaggaggtcgactaa</cdnaseq> |
| Protein Sequence |
<aaseq>MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSY VGFTDSERLIGDAAKNQVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPG DKPMIVVQYKGEEKQFAAEEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ ATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTI EEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERA KRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDK SSVHDVVLVGGSTRIPRVQQLLQDFFNGKELCKNINPDEAVAYGAAVQAAILSGEGNE KVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYE GERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKIT ITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIKDEKIAS KLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPIIAKMYQGAGADM AGGMDEDDAPPAGGSGAGPKIEEVD</aaseq> |
| Gene Sequence |
<dnaseqindica>72..285#2200..3935#ctctcccactcttcctcctccccaaaccctagccgccgccgccggcgtactcgagagaaacatcagcatccatggcgggcaagggcgagggtccggccatcggcatcgaccttggcacgacctactcgtgcgtgggcgtttggcagcacgaccgcgtggagatcatcgccaacgaccagggcaaccgcaccaccccctcctacgtcggcttcaccgactccgagaggctcatcggagatgctgccaagaaccaggtcgccatgaaccccatcaacaccgtctttggtaactacttattccctgctcctcagtcctctctctttctctctctccccccttagatctcatctctaaggtcttcgtcgtcgtcgtatgctagatctactcttgcccagctcgttcagatctgttagatttgtgtgggatgctctaattaattactaccaacttagtagatctggaactcttttgacttgcagatcttgctccactcctgttgcattttgaatctgtgttgatgtgatttaagttgttggcagtgctttttgcatactatttgaatttgtggatggttagcagtcagtacactaggatttattactggatctggacagatatgctcgtttcaatcggctcgatttgctatgttgatagctaacatgttgtgcttgtcctactgccctggcgcaaatttgatccatgcattcttttcgttaaatgatttgtcaagtagtaatgcttgtttgaaaatgatattattattattattattattttaaataaatatagcctgaaacattcttagtttcgaggagaagtgatgatgtcttatccataccacatgtctgcatctcatatgatgattaatctacatcatgcactaccatctgatctcctctagctcatacagcttttaacaagttaggcgatagatgtttgctacaaacagtcaactggatttgctttcttgaaagaaaaaaaatgaaccgtgtagtttgcaacctgtgatgtaaattaacccatttactgaactacattgattatttcagtaaaatcaccatctttcggctgaggttgcatgcttagttattatatttttaccaatgatgattttgttatgtagccagatactgtactttcttatgccatttggtatctgactcattgtctacttttgtgactatgtgtctcgaaatatggcatataataagggggaacggatcttgcgacattgatggctcctgtatgagcctccaattactatatagccgtttacatgttcttatcatgttacttttccaaattagtgctgcacatcttgtctgtttgcaagtttgggttcattcatattgctgtgggcattttaatacatcttaactataatgtaaatttcttgtacatcgctaaaattttctgccttgattgagtagactcttagatgacatctatcttaccttatgcacttgattcgtatttctgttacaacattttgattacttgatgtagttcacacaagcatgacacatctctttgaaaaaaagatttcattttttaaagcaagcctaatgctttagggtgggagaagtgatgatacttaatccatacaacatttctgcatctcagatgatgatcaatctacatcatgcactaccatctgatctccccatcatacaattttttattttgttttgttggattatataactttaacatttgataaagtgccaacagatttttatacacaatttcttatagatattaccatgacagcttgcagcctgtgatgcaaaagtacccattaaactgaattacactgattattccaaacaaatcaccatctttcggctgaggttgcttgcttgtttaaaattatgaatgcttcttgcacaaccatttaggactttcggtagtttgtaatgccatttggtatctgacacatggtctgcgcttgtgactatttgtcttgaaatatggcataaaacaagggggaacggatcttgcgacattggtggttcctctatgatcctccaattactatatagctgtttacaatttgttaagttaggagcataccttttgctttgtcatcaaagtcttggttcctttgtatttctagttcagattcatttttcttcagcttttgaaacataaactcagtatatttttactgtaattgctgacattgagtcttctctgcagatgccaagcgtctcattggcaggaggtttagcgatgcttctgttcagagtgacattaagctctggcccttcaaggtgattgctggacctggtgacaagcctatgattgttgtccagtacaagggtgaggagaagcagtttgctgcagaagagatctcctccatggtcctcatcaagatgcgtgagattgctgaggcctaccttggcaccaccatcaagaatgccgttgtcactgttcctgcctacttcaatgactcccagaggcaggccaccaaggatgctggagtgattgctggtctcaatgtcatgcgtatcatcaacgagccgactgctgcagctattgcctatggtcttgataagaaggccaccagcgttggtgagaagaatgtcctcatctttgaccttggaggtggtacctttgatgtctccctccttaccattgaggagggtatctttgaggtcaaggccacagctggtgacacccatcttggtggtgaagattttgacaatcgtatggtcaaccactttgtgcaagaattcaagaggaagaacaagaaggatatcactggcaaccccagggctctcaggaggttgaggacagcttgtgagagggcaaagaggaccctgtcctccactgcccagaccaccattgagatcgattccctgtatgagggcatcgacttctactcaaccatcacccgtgccaggtttgaggagctcaacatggatctcttcaggaagtgtatggagcctgtggagaagtgcctcagggatgctaagatggacaagagctctgttcatgatgttgtccttgttggtggctccactaggatcccgagggtgcagcagctcctgcaggatttcttcaacggcaaggagctttgcaagaacatcaacccagatgaggctgttgcttatggtgctgctgtccaggctgccatcttgagtggtgagggcaacgagaaggtccaggacctcctcctgttggatgttacccctctctctctcggtttggagactgctggtggtgtcatgaccgttttgatcccaaggaacaccaccattcccaccaagaaggagcaggtcttctccacctactccgacaaccagcctggtgtgctcatccaggtttatgagggtgagaggaccaggacacgtgacaacaacctgctggggaagtttgagctctctggaatccctcctgctcccaggggtgttccacagatcactgtttgcttcgacattgatgccaatggtatcctgaacgtgtctgctgaggacaagaccaccgggcagaagaacaagatcaccattaccaacgacaagggcaggcttagcaaggaggagattgagaagatggtccaggaggccgagaagtacaagtcagaggatgaggagcacaagaagaaggtggagtccaagaacgcgctggagaactacgcctacaacatgcgcaacaccatcaaggatgagaagatcgcctcgaagctcccggcagcggacaagaagaagatcgaggatgccatcgaccaggccatccagtggctggacggcaaccagctcgctgaggctgatgagttcgatgacaagatgaaggagctggagggcatctgcaaccccatcatcgccaagatgtaccagggcgctggcgcggacatggccggcggcatggacgaggacgatgctcccccggctggcggcagcggtgctggccccaagatcgaggaggtcgactaagcgcgaaatttgctagtgatccgcgcttcaagttatcttattgcattattagtgtctcttttatgttgtgttaaaaaactttgctgctatgacttatgatgatacccttggtctgtttgggcagtccttttgaattgaagaactgcgttgggagctctatgagaactatgaattgcgtgagaaatttaattattgtggtgcttgcagcgcctattatttggtctctgtcccacgtttattatttgcatgtgcgcattgtttgctagcaattgctgttgtgcttctcagccaacatgtaaactgtttggattgtttctgatttttggatgcattttttaaagcggatagtgaaggacgg</dnaseqindica> |
| External Link(s) |