Difference between revisions of "Os01g0919900"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
Fatty acids and their derivatives play important signaling roles in plant defense responses. It has been shown that suppressing a gene for stearoyl acyl carrier protein fatty-acid desaturase (SACPD) enhances the resistance of Arabidopsis (SSI2) and soybean to multiple pathogens. we present functional analyses of a rice homolog of SSI2(OsSSI2) in disease resistance of rice plants.[1]
  
 
===Expression===
 
===Expression===

Revision as of 11:16, 3 June 2014

Gene Os01g0919900,namely OsSSI2,meaning fatty-acid desaturase gene, is involved in the negative regulation of defense responses in rice, as are itsArabidopsis and soybean counterparts.

Annotated Information

Function

Fatty acids and their derivatives play important signaling roles in plant defense responses. It has been shown that suppressing a gene for stearoyl acyl carrier protein fatty-acid desaturase (SACPD) enhances the resistance of Arabidopsis (SSI2) and soybean to multiple pathogens. we present functional analyses of a rice homolog of SSI2(OsSSI2) in disease resistance of rice plants.[1]

Expression

A transposon insertion mutation (Osssi2-Tos17) and RNAi-mediated knockdown of OsSSI2 (OsSSI2-kd) reduced the oleic acid (18:1) level and increased that of stearic acid (18:0), indicating that OsSSI2 is responsible for fatty-acid desaturase activity. These plants displayed spontaneous lesion formation in leaf blades, retarded growth, slight increase in endogenous free salicylic acid (SA) levels, and SA/benzothiadiazole (BTH)-specific inducible genes, includingWRKY45, a key regulator of SA/BTH-induced resistance, in rice. Moreover, the OsSSI2-kd plants showed markedly enhanced resistance to the blast fungus Magnaporthe grisea and leaf-blight bacteria Xanthomonas oryzae pv. oryzae. These results suggest that OsSSI2 is involved in the negative regulation of defense responses in rice, as are itsArabidopsis and soybean counterparts. [1]

Evolution

Microarray analyses identified 406 genes that were differentially expressed (≥2-fold) in OsSSI2-kd rice plants compared with wild-type rice and, of these, approximately 39% were BTH responsive. Taken together, our results suggest that induction of SA-responsive genes, including WRKY45, is likely responsible for enhanced disease resistance in OsSSI2-kd rice plants.[1]

Labs working on this gene

  • Plant Disease Resistance Research Unit, Division of Plant Science, National Institute of Agrobiological Sciences,Kannondai 2-1-2, Tsukuba, 305-8602 Japan
  • College of Agriculture, Ibaraki University, Ami 300-0393, Japan

References

Please input cited references here.

Structured Information

Gene Name

Os01g0919900

Description

Similar to Acyl-[acyl-carrier-protein] desaturase, chloroplast precursor (EC 1.14.19.2) (Stearoyl-ACP desaturase) (Delta(9) stearoyl-acyl carrier protein desaturase)

Version

NM_001051750.1 GI:115441870 GeneID:4327738

Length

3991 bp

Definition

Oryza sativa Japonica Group Os01g0919900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:41902665..41906655

Sequence Coding Region

41902993..41903553,41903893..41904391,41906418..41906560

Expression

GEO Profiles:Os01g0919900

Genome Context

<gbrowseImage1> name=NC_008394:41902665..41906655 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:41902665..41906655 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgtcgaggatggcgctccggcccaacgacgtcacgctccgcctcaccccgcccctcgccgccgccgcgcggcgcaaccgccgcgccgccgccggcggtgtcagggtctacgccgtcgcgtccggggccgtctccaccaaggttgagaacaagaagccatttgctcctccacgagaggtgcacgtccaggttacacattccatgccaccccagaagattgaaatattcaagtctcttgatgattgggccagagataatattttgtcccaccttaagcctgtcgagaaatgttggcaaccacaggattttcttcctgatccagcctcagatgggtttcatgatgaagtcaaagaacttagagaacgtgccaaggaaattcctgatgattattttgtttgtttggttggagacatgattacggaggaagctcttcctacgtaccagactatgcttaacactctcgatggtgtccgagatgaaacaggtgcaagccccactgcctgggctgtttggacaagggcatggactgctgaggagaacaggcatggtgacctcctgaacaaatatctctacctcactggtagggtggacatgagacaaattgagaagacaattcagtatcttattggctctggaatggaccctaggacagagaacaatccttatcttggattcatctacacctccttccaagagcgtgcgaccttcatctcacatgggaacactgctcgccatgccaaagactttggcgacctaaaacttgcacagatctgtggcatcatcgcctcagatgagaagcgtcatgagactgcatacaccaagattgttgagaagctgtttgagattgaccctgatggcactgtgcttgcttttgctgacatgatgaagaagaagatctcgatgcctgcccacctgatgttcgatggggaggatgataagctctttgagcacttctccatggttgcacagaggcttggtgtttacaccgccaaggactacgccgacatccttgagttcctcgttagcaggtggaagatatctgacctgactggcctatctagcgagggaaacaaggcgcaagactacctttgcacccttgctgctaggatcagaaggctggatgagagggcacaatcgagagccaagaaagctggtacattgcctttcagctgggtatatggtagggaagttcaactctga</cdnaseq>

Protein Sequence

<aaseq>MASRMALRPNDVTLRLTPPLAAAARRNRRAAAGGVRVYAVASGA VSTKVENKKPFAPPREVHVQVTHSMPPQKIEIFKSLDDWARDNILSHLKPVEKCWQPQ DFLPDPASDGFHDEVKELRERAKEIPDDYFVCLVGDMITEEALPTYQTMLNTLDGVRD ETGASPTAWAVWTRAWTAEENRHGDLLNKYLYLTGRVDMRQIEKTIQYLIGSGMDPRT ENNPYLGFIYTSFQERATFISHGNTARHAKDFGDLKLAQICGIIASDEKRHETAYTKI VEKLFEIDPDGTVLAFADMMKKKISMPAHLMFDGEDDKLFEHFSMVAQRLGVYTAKDY ADILEFLVSRWKISDLTGLSSEGNKAQDYLCTLAARIRRLDERAQSRAKKAGTLPFSW VYGREVQL</aaseq>

Gene Sequence

<dnaseqindica>3103..3663#2265..2763#96..238#acacccccatcccctctctccgcgcctcgcctcgccacccgcatcgccatctcgcaccgccacctcctccactctcggcggcgggggcctcatcgatggcgtcgaggatggcgctccggcccaacgacgtcacgctccgcctcaccccgcccctcgccgccgccgcgcggcgcaaccgccgcgccgccgccggcggtgtcagggtctacgccgtcgcgtccggggccgtctccaccaagtaagctcgcccccgctccgctcgccactctcctctaatccctctctatcgacctcgtcgcgttcgggattggttccccgtgtgttgggttgggttcgatgcatcggtttgctctgggcgacgcctcgccgccgctgcgtagggatttccggtgcacctgtccccggattggcgcggcgattcggggttcgtcgacgttgcggcatgaatgcgtgtctctcttacccaggattcggtttttcttctcttcgttttgcttgcctcgtctgggttttgtctcaaattctgcgccgtctccgttcctcgtcgccggctttggcaccggtgccaggaatcgtgagattcatcctcgtccgtgtcgcgcgctctccctacgcgcatggccgctgcatctcgccgctgcctcagatcaggctgcaaagatttgcagcttcgccgttcaatcattcgtgcagcatacagtaggtcggtttcactgtatgaactggcgacctgctccaccacggcttctccgttgcaagcaaagtgaagctactagctcgagttagtccctttcacattcatttttgacgccgcatttcaccggcattaaatttgctgggaccttcataccttcaagcttgtactctggaaccatactctccattaatatatcgctgtactgcacaaggaaaatcggtggtacacaacagtatcgatttgaagaacctctttaggggggcttccatggggactccaaggcgttcctatcgttgtcagcccgatttggtggcccgtggtccacagcatggtgatgttgctcgcagtgtcatggaatttaatttgatttgttcttcgcttgttagtaccactggactcctaggtagagatgctttatggcagctcagtgtcgctgacctgtttagttgacgggttctagagtcatttaatacagtatggcattggaaggaggttggttgtgtcctatcctaggcatggcactgaaatggaatcacctccatactccacccctgtcctgggtttcttgatcggattatttgctccatttctctataaaaatgtatttgctcggagtatttatttagtattgttccattttctgatatttacaaactgataccctggaaatcagattgtttttctgagagggtggatatcatagttactgcttaaaccttacccaaagttaaatttttctagttacttccagtagttaaactggcatgaatgcaagatggcagatttgactgcttggtccaattagttccacctggctgatcttatttctatttctgcacaccctgctgcagcaaaaattgtgttccccccagagatgctgcccatgcccagctacagtgatatgcagggcttccaggctaaaacgcgcaggaaagacatccttgctgtatatcaggatttctttagcctatgcattaatacgttcagtatggggagatcctcgcaccataatttatagagcatggcatgtgactgtagtgtggacaaggtcaatgatattagctagtagtactaacctaactgcattttcgctttgtctacctgatgaactctagagaggccaagaagctaaagcttattgcacacttcagttgttgtgcataatctaccgttttgtcaaaagaacagtccaaccataactgatttaattttaaccttaagggaaaaaaatattaggatgaccatcaaactagtacgattagtcttctttatcttgacaaagctgaatggaaaccgtacaggtcaccattctaagcatacctatacatatattttacaactcaggtgtaatctgtttcttttcttttctttgggagggtgttgcttttaacagtgtcccatcagtgtccctcttgtcaaagtttaaccttgtaaatttgtaaatactccctaaattaatgaaatttggccggcctagtctttggccagcctggcaaatgcctaaagctagaggtatattcatcatgtgtctggtagttgctgaaagtttgtttaatttttgtatcagggttgagaacaagaagccatttgctcctccacgagaggtgcacgtccaggttacacattccatgccaccccagaagattgaaatattcaagtctcttgatgattgggccagagataatattttgtcccaccttaagcctgtcgagaaatgttggcaaccacaggattttcttcctgatccagcctcagatgggtttcatgatgaagtcaaagaacttagagaacgtgccaaggaaattcctgatgattattttgtttgtttggttggagacatgattacggaggaagctcttcctacgtaccagactatgcttaacactctcgatggtgtccgagatgaaacaggtgcaagccccactgcctgggctgtttggacaagggcatggactgctgaggagaacaggcatggtgacctcctgaacaaatatctctacctcactggtagggtggacatgagacaaattgagaagacaattcagtatcttattggctctggaatggtaacagttttcttccgcttctttgctagcctagctatatttaactgattattttgaaattgtcattcatgagtttttccctcaagcaattgttttcctcactggctagcgtatattagcatgatgtttttgaaaaactcttttgagttttgaggaagctagtaactccactaactacatactttaggaataacttttacctggcattatcaattttctaattttttagtcttatgttcttttgctctgttctattctgttctgttcacattggactgtttaagtggcaattgagcagagaaatctgtagcacttactcttttgctgcatcatttccaggaccctaggacagagaacaatccttatcttggattcatctacacctccttccaagagcgtgcgaccttcatctcacatgggaacactgctcgccatgccaaagactttggcgacctaaaacttgcacagatctgtggcatcatcgcctcagatgagaagcgtcatgagactgcatacaccaagattgttgagaagctgtttgagattgaccctgatggcactgtgcttgcttttgctgacatgatgaagaagaagatctcgatgcctgcccacctgatgttcgatggggaggatgataagctctttgagcacttctccatggttgcacagaggcttggtgtttacaccgccaaggactacgccgacatccttgagttcctcgttagcaggtggaagatatctgacctgactggcctatctagcgagggaaacaaggcgcaagactacctttgcacccttgctgctaggatcagaaggctggatgagagggcacaatcgagagccaagaaagctggtacattgcctttcagctgggtatatggtagggaagttcaactctgagcatcagacgccattgcgacttcttcgagctccagtgttactactgtccgtgcttgtcgagacacattttgagaacaataccaggtgtgtcttgctacatagttcttcaggttgaccaaatgaactgagggcatatgttcgtggtatctttgcttagagtgatagagagatttgcgtctgtgttttagctctttttttcttttctgccttttcatgtacaacttctggccgtgtggattggacatgtactgaacgtgagtctgtcgttggccgtgtcaatctgctcgtgtgtttaaactggctgctgttcaggtctgaaaattttgtg</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0919900, RefSeq:Os01g0919900