Difference between revisions of "Os10g0491000"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
This gene is originaly derived from the ''Oryza sativa Japonica Group''(cultivar: Nipponbare). It encodes a kind of basic secretory protein in rice suspension-cultured cells. And study shows that this protein showed homology to proteins induced by biotic stress in the Arabidopsis.[1].The protein belongs to BSP surperfamily. BSP,Peptidase of plants and bacteria; These basic secretory proteins (BSPs) are believed to be part of the plants defence mechanism against pathogens. SO we believe that the gene will upregulate and plays an important roe in the process of against pathogens.The following is its BSP domain and its structure.
 
This gene is originaly derived from the ''Oryza sativa Japonica Group''(cultivar: Nipponbare). It encodes a kind of basic secretory protein in rice suspension-cultured cells. And study shows that this protein showed homology to proteins induced by biotic stress in the Arabidopsis.[1].The protein belongs to BSP surperfamily. BSP,Peptidase of plants and bacteria; These basic secretory proteins (BSPs) are believed to be part of the plants defence mechanism against pathogens. SO we believe that the gene will upregulate and plays an important roe in the process of against pathogens.The following is its BSP domain and its structure.
[[File:BSP nmm1.jpg|right|thumb|300px|]]
+
[[File:BSP gene structure.jpg|right|thumb|300px|BSP gene structure.'']]
  
 
===Expression===
 
===Expression===

Revision as of 07:32, 4 June 2014

Please input one-sentence summary here.

Annotated Information

Function

This gene is originaly derived from the Oryza sativa Japonica Group(cultivar: Nipponbare). It encodes a kind of basic secretory protein in rice suspension-cultured cells. And study shows that this protein showed homology to proteins induced by biotic stress in the Arabidopsis.[1].The protein belongs to BSP surperfamily. BSP,Peptidase of plants and bacteria; These basic secretory proteins (BSPs) are believed to be part of the plants defence mechanism against pathogens. SO we believe that the gene will upregulate and plays an important roe in the process of against pathogens.The following is its BSP domain and its structure.

BSP gene structure.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

1.Rupali Bhalerao, Johanna Keskitalo, Fredrik Sterky,et al. Gene Expression in Autumn Leaves.Plant Physiology, 2003,2(131): 430–442.

Structured Information

Gene Name

Os10g0491000

Description

Plant Basic Secretory Protein family protein

Version

NM_001071461.1 GI:115482665 GeneID:4348974

Length

1486 bp

Definition

Oryza sativa Japonica Group Os10g0491000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:19097598..19099083

Sequence Coding Region

19097618..19097965,19098596..19098937

Expression

GEO Profiles:Os10g0491000

Genome Context

<gbrowseImage1> name=NC_008403:19097598..19099083 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:19097598..19099083 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgaagcttcacgtcgtggcagccatcctgctggccgtggccgcgtcgtcgtcgccgccgcccgccgccgccgtcacctacgaggtgagcaacgaggcggcgagcaccgccggcggccagcggttcgaccgggagtacggcgccgggtacgccaagcaggtgctcgccgccgcctcctccttcacctggagcatcttcagccagccgagcgccgccgaccggaggcccgtcgacgccgtcgtcctcgccgtccgcgacgtcgacggcatcgcctccaccagcggcaacaccatcacgctcggcgccggctacgtcgccggcgtcaccggcaacgacttcaagacgcaggtgaccggagtgttgtaccatgaggtggtgcacgtgtggcagtgggggctgcaggattacggggcgcattcgtgggtgtacgaggggatcgccgactttgtgcggctgcgcgccggctacccagcggctggttgggtgcagccggggcaagggaacagctgggaggacagctactccgtgacggcgaggttcttcgactactgcgacagcgtcaagccagggttcgttgccgacctgaacgctaagctgaagaatgggtacaacgtcgactacttcgtgcagatcaccgggaagaccgtgcagcagctgtggcaggattacaaggccaagtatggaaactga</cdnaseq>

Protein Sequence

<aaseq>MKLHVVAAILLAVAASSSPPPAAAVTYEVSNEAASTAGGQRFDR EYGAGYAKQVLAAASSFTWSIFSQPSAADRRPVDAVVLAVRDVDGIASTSGNTITLGA GYVAGVTGNDFKTQVTGVLYHEVVHVWQWGLQDYGAHSWVYEGIADFVRLRAGYPAAG WVQPGQGNSWEDSYSVTARFFDYCDSVKPGFVADLNAKLKNGYNVDYFVQITGKTVQQ LWQDYKAKYGN</aaseq>

Gene Sequence

<dnaseqindica>21..368#999..1340#actcaccaagaccaccagacatgaagcttcacgtcgtggcagccatcctgctggccgtggccgcgtcgtcgtcgccgccgcccgccgccgccgtcacctacgaggtgagcaacgaggcggcgagcaccgccggcggccagcggttcgaccgggagtacggcgccgggtacgccaagcaggtgctcgccgccgcctcctccttcacctggagcatcttcagccagccgagcgccgccgaccggaggcccgtcgacgccgtcgtcctcgccgtccgcgacgtcgacggcatcgcctccaccagcggcaacaccatcacgctcggcgccggctacgtcgccggcgtcaccggcaacgacttcaagacgcaggtaattaatagactccggctcatccatgttgactgactaaaattttgaccatccaaactatacacctagactgtgtttagactgtgtttagtttacgtcaaaattaaaagtttggttaaaattagaacgatgtgatgaaaaagtttaaagtttatgtgtgtagaaaagttttaatgtgatggaaaaattggaagtttgaagaaaaacttcggatctaaacatggtgacaatcaacgataatatttacggtgttcctactaagacttcgttcggcaatggctaaattaaagagagtaaaactatttcgttttctgcacgcacgtcccaaacattgtgtttatttttaaaaagttctagaaaagttatttttaaaaatatatcaattcgttttttaatttaaaataattaatgcttaattaaatcatacactaattgctcatcttgttttatatatcttctcaatttttctctttcccatcatcttaaacacacccactttaataaatgtgaccatagatgactagaattccaaccccgatcgatgtccccaaacaaaattaaatctaatcaaccacaacttttacgacaatctctagtttttccaaataatcaagttattttttctcataggtgaccggagtgttgtaccatgaggtggtgcacgtgtggcagtgggggctgcaggattacggggcgcattcgtgggtgtacgaggggatcgccgactttgtgcggctgcgcgccggctacccagcggctggttgggtgcagccggggcaagggaacagctgggaggacagctactccgtgacggcgaggttcttcgactactgcgacagcgtcaagccagggttcgttgccgacctgaacgctaagctgaagaatgggtacaacgtcgactacttcgtgcagatcaccgggaagaccgtgcagcagctgtggcaggattacaaggccaagtatggaaactgatgatcgatcgacgcagagaatgaataagacaagagattaccatcattgattgatatagattgttgtaactcatagctatggagtttacacaattattgtattgcttacggatgatagaataaagggacgctgtctagttttcaatc</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0491000, RefSeq:Os10g0491000