Difference between revisions of "Os10g0491000"

From RiceWiki
Jump to: navigation, search
(Expression)
(Expression)
Line 9: Line 9:
  
 
===Expression===
 
===Expression===
   The gene encodes a protein and it has 15 GEO profiles. Abscisic acid and gibberellin effect on calluses (dye-swap)
+
   The gene encodes a protein and it has 15 GEO profiles.[[File:GEO profile1.jpg|right|thumb|300px|GEO profile1.'']],
 +
[[File:GEO profile2.jpg|right|thumb|300px|GEO profile2.'']];[[File:GEO profile3.jpg|right|thumb|300px|GEO profile3.'']]
 +
[[File:GEO profile4.jpg|right|thumb|300px|GEO profile4.'']];[[File:GEO profile5.jpg|right|thumb|300px|GEO profile5.'']];
 +
[[File:GEO profile6.jpg|right|thumb|300px|GEO profile6.'']];[[File:GEO profile7.jpg|right|thumb|300px|GEO profile7.'']];
 +
[[File:GEO profile8.jpg|right|thumb|300px|GEO profile8.'']];[[File:GEO profile9.jpg|right|thumb|300px|GEO profile9.'']];
 +
[[File:GEO profile10.jpg|right|thumb|300px|GEO profile10.'']];[[File:GEO profile11.jpg|right|thumb|300px|GEO profile11.'']];
 +
[[File:GEO profile12.jpg|right|thumb|300px|GEO profile12.'']];[[File:GEO profile13.jpg|right|thumb|300px|GEO profile13.'']];
 +
[[File:GEO profile14.jpg|right|thumb|300px|GEO profile14.'']];[[File:GEO profile15.jpg|right|thumb|300px|GEO profile15.'']].
  
 
===Evolution===
 
===Evolution===

Revision as of 09:42, 4 June 2014

Please input one-sentence summary here.

Annotated Information

Function

This gene is originaly derived from the Oryza sativa Japonica Group(cultivar: Nipponbare). It encodes a kind of basic secretory protein in rice suspension-cultured cells. And study shows that this protein showed homology to proteins induced by biotic stress in the Arabidopsis.[1].The protein belongs to BSP surperfamily. BSP,Peptidase of plants and bacteria; These basic secretory proteins (BSPs) are believed to be part of the plants defence mechanism against pathogens. SO we believe that the gene will upregulate and plays an important roe in the process of against pathogens.The following is its BSP domain and its structure.
BSP gene structure.
BSP domain.
 15 molecular pathways with links to genes including menbrane-bounded organelle、cytolasmic vesicle、cytomlasm、vesicle、cell and cellular component and so on. The protein of the gene encodes is the basic structural and functional unit of all organisms. Includes the plasma membrane and any external encapsulating structures such as the cell wall and cell envelope.

[1]

Expression

The gene encodes a protein and it has 15 GEO profiles.
GEO profile1.
,
GEO profile2.
;
GEO profile3.
GEO profile4.
;
GEO profile5.
;
GEO profile6.
;
GEO profile7.
;
GEO profile8.
;
GEO profile9.
;
GEO profile10.
;
GEO profile11.
;
GEO profile12.
;
GEO profile13.
;
GEO profile14.
;
GEO profile15.
.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

1.Triticeae Research Institute, Sichuan Agricultural University, Wenjiang, Chengdu, 611130 Sichuan, China; 2.Key Laboratory of Southwestern Crop Germplasm Utilization, Ministry of Agriculture, Sichuan Agricultural University, Wenjiang, Chengdu, 611130 Sichuan, China; 3.CSIRO Plant Industry, 306 Carmody Road,St Lucia, QLD 4067, Australia; 4.Umea Plant Science Center, Department of Plant Physiology, Umea University, 901 87 Umea, Sweden; 5. Department of Biotechnology, Kungliga Tekniska Ho¨ gskolan, Royal Institute of Technology, Stockholm Center for Physics, Astronomy, and Biotechnology,106 91 Stockholm, Sweden ; 6. The Institute for Genomic Research Rockville, MD 20850, USA; 7.

References

1.Rupali Bhalerao, Johanna Keskitalo, Fredrik Sterky,et al. Gene Expression in Autumn Leaves.Plant Physiology, 2003,2(131): 430–442. 2.Wei Tao Li, Chunji Liu, YaXi Liu,et al.Meta-analysis of QTL associated with tolerance to abiotic stresses in barley.Euphytica, 2013,189:31–49

Structured Information

Gene Name

Os10g0491000

Description

Plant Basic Secretory Protein family protein

Version

NM_001071461.1 GI:115482665 GeneID:4348974

Length

1486 bp

Definition

Oryza sativa Japonica Group Os10g0491000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:19097598..19099083

Sequence Coding Region

19097618..19097965,19098596..19098937

Expression

GEO Profiles:Os10g0491000

Genome Context

<gbrowseImage1> name=NC_008403:19097598..19099083 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:19097598..19099083 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgaagcttcacgtcgtggcagccatcctgctggccgtggccgcgtcgtcgtcgccgccgcccgccgccgccgtcacctacgaggtgagcaacgaggcggcgagcaccgccggcggccagcggttcgaccgggagtacggcgccgggtacgccaagcaggtgctcgccgccgcctcctccttcacctggagcatcttcagccagccgagcgccgccgaccggaggcccgtcgacgccgtcgtcctcgccgtccgcgacgtcgacggcatcgcctccaccagcggcaacaccatcacgctcggcgccggctacgtcgccggcgtcaccggcaacgacttcaagacgcaggtgaccggagtgttgtaccatgaggtggtgcacgtgtggcagtgggggctgcaggattacggggcgcattcgtgggtgtacgaggggatcgccgactttgtgcggctgcgcgccggctacccagcggctggttgggtgcagccggggcaagggaacagctgggaggacagctactccgtgacggcgaggttcttcgactactgcgacagcgtcaagccagggttcgttgccgacctgaacgctaagctgaagaatgggtacaacgtcgactacttcgtgcagatcaccgggaagaccgtgcagcagctgtggcaggattacaaggccaagtatggaaactga</cdnaseq>

Protein Sequence

<aaseq>MKLHVVAAILLAVAASSSPPPAAAVTYEVSNEAASTAGGQRFDR EYGAGYAKQVLAAASSFTWSIFSQPSAADRRPVDAVVLAVRDVDGIASTSGNTITLGA GYVAGVTGNDFKTQVTGVLYHEVVHVWQWGLQDYGAHSWVYEGIADFVRLRAGYPAAG WVQPGQGNSWEDSYSVTARFFDYCDSVKPGFVADLNAKLKNGYNVDYFVQITGKTVQQ LWQDYKAKYGN</aaseq>

Gene Sequence

<dnaseqindica>21..368#999..1340#actcaccaagaccaccagacatgaagcttcacgtcgtggcagccatcctgctggccgtggccgcgtcgtcgtcgccgccgcccgccgccgccgtcacctacgaggtgagcaacgaggcggcgagcaccgccggcggccagcggttcgaccgggagtacggcgccgggtacgccaagcaggtgctcgccgccgcctcctccttcacctggagcatcttcagccagccgagcgccgccgaccggaggcccgtcgacgccgtcgtcctcgccgtccgcgacgtcgacggcatcgcctccaccagcggcaacaccatcacgctcggcgccggctacgtcgccggcgtcaccggcaacgacttcaagacgcaggtaattaatagactccggctcatccatgttgactgactaaaattttgaccatccaaactatacacctagactgtgtttagactgtgtttagtttacgtcaaaattaaaagtttggttaaaattagaacgatgtgatgaaaaagtttaaagtttatgtgtgtagaaaagttttaatgtgatggaaaaattggaagtttgaagaaaaacttcggatctaaacatggtgacaatcaacgataatatttacggtgttcctactaagacttcgttcggcaatggctaaattaaagagagtaaaactatttcgttttctgcacgcacgtcccaaacattgtgtttatttttaaaaagttctagaaaagttatttttaaaaatatatcaattcgttttttaatttaaaataattaatgcttaattaaatcatacactaattgctcatcttgttttatatatcttctcaatttttctctttcccatcatcttaaacacacccactttaataaatgtgaccatagatgactagaattccaaccccgatcgatgtccccaaacaaaattaaatctaatcaaccacaacttttacgacaatctctagtttttccaaataatcaagttattttttctcataggtgaccggagtgttgtaccatgaggtggtgcacgtgtggcagtgggggctgcaggattacggggcgcattcgtgggtgtacgaggggatcgccgactttgtgcggctgcgcgccggctacccagcggctggttgggtgcagccggggcaagggaacagctgggaggacagctactccgtgacggcgaggttcttcgactactgcgacagcgtcaagccagggttcgttgccgacctgaacgctaagctgaagaatgggtacaacgtcgactacttcgtgcagatcaccgggaagaccgtgcagcagctgtggcaggattacaaggccaagtatggaaactgatgatcgatcgacgcagagaatgaataagacaagagattaccatcattgattgatatagattgttgtaactcatagctatggagtttacacaattattgtattgcttacggatgatagaataaagggacgctgtctagttttcaatc</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0491000, RefSeq:Os10g0491000