Difference between revisions of "Os10g0491000"
(→Expression) |
(→Labs working on this gene) |
||
| Line 31: | Line 31: | ||
5. Department of Biotechnology, Kungliga Tekniska Ho¨ gskolan, Royal Institute of Technology, Stockholm Center for Physics, Astronomy, and Biotechnology,106 91 Stockholm, Sweden ; | 5. Department of Biotechnology, Kungliga Tekniska Ho¨ gskolan, Royal Institute of Technology, Stockholm Center for Physics, Astronomy, and Biotechnology,106 91 Stockholm, Sweden ; | ||
6. The Institute for Genomic Research Rockville, MD 20850, USA; | 6. The Institute for Genomic Research Rockville, MD 20850, USA; | ||
| − | 7. | + | 7.Arizona Genomics Institute, University of Arizona, Tucson, AZ 85721-0036, USA, |
| + | 8.Cold Spring Harbor Laboratory Cold Spring Harbor, NY 11724, USA | ||
| + | 9.The Plant Genome Initiative at Rutgers, Waksman Institute, Rutgers University, Piscataway, NJ 08854, USA | ||
==References== | ==References== | ||
Revision as of 12:16, 4 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
This gene is originaly derived from the Oryza sativa Japonica Group(cultivar: Nipponbare). It encodes a kind of basic secretory protein in rice suspension-cultured cells. And study shows that this protein showed homology to proteins induced by biotic stress in the Arabidopsis.[1].The protein belongs to BSP surperfamily. BSP,Peptidase of plants and bacteria; These basic secretory proteins (BSPs) are believed to be part of the plants defence mechanism against pathogens. SO we believe that the gene will upregulate and plays an important roe in the process of against pathogens.The following is its BSP domain and its structure.15 molecular pathways with links to genes including menbrane-bounded organelle、cytolasmic vesicle、cytomlasm、vesicle、cell and cellular component and so on. The protein of the gene encodes is the basic structural and functional unit of all organisms. Includes the plasma membrane and any external encapsulating structures such as the cell wall and cell envelope.
Expression
The gene encodes a protein in Oryza sativa and it has 15 GEO profiles. and these GEO profiles suggest that the product of the gene is very important for Oryza sativa. The following pictures are the 15 GEO profiles,and we can see its related functions., ; ;; ;; ;; ;; ;; ;.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
1.Triticeae Research Institute, Sichuan Agricultural University, Wenjiang, Chengdu, 611130 Sichuan, China; 2.Key Laboratory of Southwestern Crop Germplasm Utilization, Ministry of Agriculture, Sichuan Agricultural University, Wenjiang, Chengdu, 611130 Sichuan, China; 3.CSIRO Plant Industry, 306 Carmody Road,St Lucia, QLD 4067, Australia; 4.Umea Plant Science Center, Department of Plant Physiology, Umea University, 901 87 Umea, Sweden; 5. Department of Biotechnology, Kungliga Tekniska Ho¨ gskolan, Royal Institute of Technology, Stockholm Center for Physics, Astronomy, and Biotechnology,106 91 Stockholm, Sweden ; 6. The Institute for Genomic Research Rockville, MD 20850, USA; 7.Arizona Genomics Institute, University of Arizona, Tucson, AZ 85721-0036, USA, 8.Cold Spring Harbor Laboratory Cold Spring Harbor, NY 11724, USA 9.The Plant Genome Initiative at Rutgers, Waksman Institute, Rutgers University, Piscataway, NJ 08854, USA
References
1.Rupali Bhalerao, Johanna Keskitalo, Fredrik Sterky,et al. Gene Expression in Autumn Leaves.Plant Physiology, 2003,2(131): 430–442. 2.Wei Tao Li, Chunji Liu, YaXi Liu,et al.Meta-analysis of QTL associated with tolerance to abiotic stresses in barley.Euphytica, 2013,189:31–49
Structured Information
| Gene Name |
Os10g0491000 |
|---|---|
| Description |
Plant Basic Secretory Protein family protein |
| Version |
NM_001071461.1 GI:115482665 GeneID:4348974 |
| Length |
1486 bp |
| Definition |
Oryza sativa Japonica Group Os10g0491000, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 10:19097598..19099083 |
| Sequence Coding Region |
19097618..19097965,19098596..19098937 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008403:19097598..19099083 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008403:19097598..19099083 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgaagcttcacgtcgtggcagccatcctgctggccgtggccgcgtcgtcgtcgccgccgcccgccgccgccgtcacctacgaggtgagcaacgaggcggcgagcaccgccggcggccagcggttcgaccgggagtacggcgccgggtacgccaagcaggtgctcgccgccgcctcctccttcacctggagcatcttcagccagccgagcgccgccgaccggaggcccgtcgacgccgtcgtcctcgccgtccgcgacgtcgacggcatcgcctccaccagcggcaacaccatcacgctcggcgccggctacgtcgccggcgtcaccggcaacgacttcaagacgcaggtgaccggagtgttgtaccatgaggtggtgcacgtgtggcagtgggggctgcaggattacggggcgcattcgtgggtgtacgaggggatcgccgactttgtgcggctgcgcgccggctacccagcggctggttgggtgcagccggggcaagggaacagctgggaggacagctactccgtgacggcgaggttcttcgactactgcgacagcgtcaagccagggttcgttgccgacctgaacgctaagctgaagaatgggtacaacgtcgactacttcgtgcagatcaccgggaagaccgtgcagcagctgtggcaggattacaaggccaagtatggaaactga</cdnaseq> |
| Protein Sequence |
<aaseq>MKLHVVAAILLAVAASSSPPPAAAVTYEVSNEAASTAGGQRFDR EYGAGYAKQVLAAASSFTWSIFSQPSAADRRPVDAVVLAVRDVDGIASTSGNTITLGA GYVAGVTGNDFKTQVTGVLYHEVVHVWQWGLQDYGAHSWVYEGIADFVRLRAGYPAAG WVQPGQGNSWEDSYSVTARFFDYCDSVKPGFVADLNAKLKNGYNVDYFVQITGKTVQQ LWQDYKAKYGN</aaseq> |
| Gene Sequence |
<dnaseqindica>21..368#999..1340#actcaccaagaccaccagacatgaagcttcacgtcgtggcagccatcctgctggccgtggccgcgtcgtcgtcgccgccgcccgccgccgccgtcacctacgaggtgagcaacgaggcggcgagcaccgccggcggccagcggttcgaccgggagtacggcgccgggtacgccaagcaggtgctcgccgccgcctcctccttcacctggagcatcttcagccagccgagcgccgccgaccggaggcccgtcgacgccgtcgtcctcgccgtccgcgacgtcgacggcatcgcctccaccagcggcaacaccatcacgctcggcgccggctacgtcgccggcgtcaccggcaacgacttcaagacgcaggtaattaatagactccggctcatccatgttgactgactaaaattttgaccatccaaactatacacctagactgtgtttagactgtgtttagtttacgtcaaaattaaaagtttggttaaaattagaacgatgtgatgaaaaagtttaaagtttatgtgtgtagaaaagttttaatgtgatggaaaaattggaagtttgaagaaaaacttcggatctaaacatggtgacaatcaacgataatatttacggtgttcctactaagacttcgttcggcaatggctaaattaaagagagtaaaactatttcgttttctgcacgcacgtcccaaacattgtgtttatttttaaaaagttctagaaaagttatttttaaaaatatatcaattcgttttttaatttaaaataattaatgcttaattaaatcatacactaattgctcatcttgttttatatatcttctcaatttttctctttcccatcatcttaaacacacccactttaataaatgtgaccatagatgactagaattccaaccccgatcgatgtccccaaacaaaattaaatctaatcaaccacaacttttacgacaatctctagtttttccaaataatcaagttattttttctcataggtgaccggagtgttgtaccatgaggtggtgcacgtgtggcagtgggggctgcaggattacggggcgcattcgtgggtgtacgaggggatcgccgactttgtgcggctgcgcgccggctacccagcggctggttgggtgcagccggggcaagggaacagctgggaggacagctactccgtgacggcgaggttcttcgactactgcgacagcgtcaagccagggttcgttgccgacctgaacgctaagctgaagaatgggtacaacgtcgactacttcgtgcagatcaccgggaagaccgtgcagcagctgtggcaggattacaaggccaagtatggaaactgatgatcgatcgacgcagagaatgaataagacaagagattaccatcattgattgatatagattgttgtaactcatagctatggagtttacacaattattgtattgcttacggatgatagaataaagggacgctgtctagttttcaatc</dnaseqindica> |
| External Link(s) |