Difference between revisions of "Os04g0415000"

From RiceWiki
Jump to: navigation, search
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
 
 +
To isolate a rice transferred DNA (T-DNA) insertion mutant, BY240, which exhibited an abaxial leaf curling phenotype that co-segregated with the inserted T-DNA. The T-DNA was inserted in the promoter of a novel gene, ACL1 (Abaxially Curled Leaf 1), and led to overexpression of this gene in BY240. Overexpression of ACL1 in wild-type rice also resulted in abaxial leaf curling. ACL1 encodes a protein of 116 amino acids with no known conserved functional domains. Overexpression of ACL2, the only homolog of ACL1 in rice, also induced abaxial leaf curling. RT–PCR analysis revealed high expressions of ACLs in leaf sheaths and leaf blades, suggesting a role for these genes in leaf development. In situ hybridization revealed non-tissue-specific expression of the ACLs in the shoot apical meristem, leaf primordium, and young leaf. Histological analysis showed increased number and exaggeration of bulliform cells and expansion of epidermal cells in the leaves of BY240, which caused developmental discoordination of the abaxial and adaxial sides, resulting in abaxially curled leaves.
  
 
===Expression===
 
===Expression===

Revision as of 10:59, 6 June 2014

Please input one-sentence summary here.

Annotated Information

Function

To isolate a rice transferred DNA (T-DNA) insertion mutant, BY240, which exhibited an abaxial leaf curling phenotype that co-segregated with the inserted T-DNA. The T-DNA was inserted in the promoter of a novel gene, ACL1 (Abaxially Curled Leaf 1), and led to overexpression of this gene in BY240. Overexpression of ACL1 in wild-type rice also resulted in abaxial leaf curling. ACL1 encodes a protein of 116 amino acids with no known conserved functional domains. Overexpression of ACL2, the only homolog of ACL1 in rice, also induced abaxial leaf curling. RT–PCR analysis revealed high expressions of ACLs in leaf sheaths and leaf blades, suggesting a role for these genes in leaf development. In situ hybridization revealed non-tissue-specific expression of the ACLs in the shoot apical meristem, leaf primordium, and young leaf. Histological analysis showed increased number and exaggeration of bulliform cells and expansion of epidermal cells in the leaves of BY240, which caused developmental discoordination of the abaxial and adaxial sides, resulting in abaxially curled leaves.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os04g0415000

Description

Conserved hypothetical protein

Version

NM_001059292.1 GI:115458313 GeneID:4335802

Length

942 bp

Definition

Oryza sativa Japonica Group Os04g0415000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:20530934..20531875

Sequence Coding Region

20531169..20531519

Expression

GEO Profiles:Os04g0415000

Genome Context

<gbrowseImage1> name=NC_008397:20530934..20531875 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:20530934..20531875 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgagccgcagcaacaagaagagctctaggggcatcgacctgaagctgaacctctcgctgccggcgagaggggactcgtcgtccaggagggcgatggccgccgacgaggagtcgtcgccgagctcgtgcctgtcgtcggagaacgagcacggcctgcagtggtccaacagcccggaggcgacgtccatggtgctcgccgcctgccctcgctgcttcatctacgtcatgctcccgcaggatgatccgcggtgcccgcagtgcaagagccccgtgatccttgacttcctgcagcaggacaacggcaacaacaacgccaacagcaatagcagcaggaagaccaggagagggtga</cdnaseq>

Protein Sequence

<aaseq>MSRSNKKSSRGIDLKLNLSLPARGDSSSRRAMAADEESSPSSCL SSENEHGLQWSNSPEATSMVLAACPRCFIYVMLPQDDPRCPQCKSPVILDFLQQDNGN NNANSNSSRKTRRG</aaseq>

Gene Sequence

<dnaseqindica>236..586#agcaagaagaccccgagcaattctacccgctcggagctcctcccctttcatcgtctccaatcaccatcatctgcacgtctcaccggccctacgcaacagtaagttccttcgccatcgccatgtcttctcctacctctaagcttcatatgacagtcgtgcaaaagtttccatttgaccaaccggctaacgaacgtttttatgggggtgtaggcaagtgggttacctctcgatcgggatgagccgcagcaacaagaagagctctaggggcatcgacctgaagctgaacctctcgctgccggcgagaggggactcgtcgtccaggagggcgatggccgccgacgaggagtcgtcgccgagctcgtgcctgtcgtcggagaacgagcacggcctgcagtggtccaacagcccggaggcgacgtccatggtgctcgccgcctgccctcgctgcttcatctacgtcatgctcccgcaggatgatccgcggtgcccgcagtgcaagagccccgtgatccttgacttcctgcagcaggacaacggcaacaacaacgccaacagcaatagcagcaggaagaccaggagagggtgaagttaaacaaaagggggggcaattctccgtttggcagaagatcaacatcaatcaagaaaaagaaaagcgtctatatgaagtcctaggtccagtaattctcttttgttttgcctattcccccagtgtaaccatgatatattccttactaaaattgtgagactagcatgaaaatccatgtgctggtggcataattttgatacatcatggatacactggggactatatccatccccctctcctggcttccttctttagtggttctaaatgaagaagttttgcttagacataggaccagacttctcatctttgttttgtttttgtttcctttccgagatgaaaagaaaacatttaccctg</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0415000, RefSeq:Os04g0415000