Difference between revisions of "Os02g0813500"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 5: Line 5:
 
Please input function information here.
 
Please input function information here.
 
The gene Os02g0813500 encodes a glutathione reductase named OsGR2. Glutathione reductase (GR; EC 1.6.4.2) is a flavoprotein oxidoreductase that catalyzes the reduction of oxidized glutathione (GSSG) to GSH with the accompanying oxidation of NADPH. GR is thought to be an important component of the glutathione ascorbate cycle, the main mechanism for the detoxification of ROS in plant.
 
The gene Os02g0813500 encodes a glutathione reductase named OsGR2. Glutathione reductase (GR; EC 1.6.4.2) is a flavoprotein oxidoreductase that catalyzes the reduction of oxidized glutathione (GSSG) to GSH with the accompanying oxidation of NADPH. GR is thought to be an important component of the glutathione ascorbate cycle, the main mechanism for the detoxification of ROS in plant.
In plants, GR is located in different cellular compartments. Three genes encoding GR have been described for Oryza sativa: a cytosolic (OsGR2) and two chloroplastic isoforms (OsGR1 and OsGR3).OsGR1, OsGR2 and OsGR3 are located on chromosomes 3, 2, and 10, respectively [1].The expression of OsGR genes is influenced by abiotic and biotic stresses known to increase ROS production: drought/desiccation, salinity, chilling, cadmium, powdery mildew and abscisic acid (ABA) treatment [2]. Changes in enzymatic activity of GR have been positively associated with salt stress tolerance in rice. NaCl treatment could induce H2O2 production in rice roots, and H2O2 treatment resulted in enhanced OsGR2 and OsGR3 induction. H2O2 is involved in regulation of OsGR2 and OsGR3 expression in NaCl treated rice roots [1].Both heat shock (HS) and cadmium( Cd) can increase H2O2 content. HS and Cd treatments increased activities of GR in rice leaves through increasing the content of H2O2. Cd did not increase the expression of OsAPX (ascorbate peroxidase) and OsGR without HS treatment [3].[[File:OsGR2 Fig.1.png]]
+
In plants, GR is located in different cellular compartments. Three genes encoding GR have been described for Oryza sativa: a cytosolic (OsGR2) and two chloroplastic isoforms (OsGR1 and OsGR3).OsGR1, OsGR2 and OsGR3 are located on chromosomes 3, 2, and 10, respectively [1].The expression of OsGR genes is influenced by abiotic and biotic stresses known to increase ROS production: drought/desiccation, salinity, chilling, cadmium, powdery mildew and abscisic acid (ABA) treatment [2]. Changes in enzymatic activity of GR have been positively associated with salt stress tolerance in rice. NaCl treatment could induce H2O2 production in rice roots, and H2O2 treatment resulted in enhanced OsGR2 and OsGR3 induction. H2O2 is involved in regulation of OsGR2 and OsGR3 expression in NaCl treated rice roots [1].Both heat shock (HS) and cadmium( Cd) can increase H2O2 content. HS and Cd treatments increased activities of GR in rice leaves through increasing the content of H2O2. Cd did not increase the expression of OsAPX (ascorbate peroxidase) and OsGR without HS treatment [3].[[File:OsGR2 Fig.1.png|right|thumb|200px|Fig. 1 Changes in mRNA levels of OsGR genes in rice roots in the presence or absence of NaCl [1].]]
  
 
===Expression===
 
===Expression===

Revision as of 11:09, 7 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. The gene Os02g0813500 encodes a glutathione reductase named OsGR2. Glutathione reductase (GR; EC 1.6.4.2) is a flavoprotein oxidoreductase that catalyzes the reduction of oxidized glutathione (GSSG) to GSH with the accompanying oxidation of NADPH. GR is thought to be an important component of the glutathione ascorbate cycle, the main mechanism for the detoxification of ROS in plant.

In plants, GR is located in different cellular compartments. Three genes encoding GR have been described for Oryza sativa: a cytosolic (OsGR2) and two chloroplastic isoforms (OsGR1 and OsGR3).OsGR1, OsGR2 and OsGR3 are located on chromosomes 3, 2, and 10, respectively [1].The expression of OsGR genes is influenced by abiotic and biotic stresses known to increase ROS production: drought/desiccation, salinity, chilling, cadmium, powdery mildew and abscisic acid (ABA) treatment [2]. Changes in enzymatic activity of GR have been positively associated with salt stress tolerance in rice. NaCl treatment could induce H2O2 production in rice roots, and H2O2 treatment resulted in enhanced OsGR2 and OsGR3 induction. H2O2 is involved in regulation of OsGR2 and OsGR3 expression in NaCl treated rice roots [1].Both heat shock (HS) and cadmium( Cd) can increase H2O2 content. HS and Cd treatments increased activities of GR in rice leaves through increasing the content of H2O2. Cd did not increase the expression of OsAPX (ascorbate peroxidase) and OsGR without HS treatment [3].
Fig. 1 Changes in mRNA levels of OsGR genes in rice roots in the presence or absence of NaCl [1].

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0813500

Description

Glutathione reductase, cytosolic (EC 1.8.1.7) (GR) (GRase)

Version

NM_001055020.1 GI:115449516 GeneID:4331112

Length

5983 bp

Definition

Oryza sativa Japonica Group Os02g0813500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:35724714..35730696

Sequence Coding Region

35725003..35725143,35725246..35725310,35725464..35725533,35725867..35725938,35726036..35726239
,35727161..35727234,35727333..35727416,35727950..35728037,35728131..35728212
,35728546..35728619,35728842..35728949,35729051..35729115,35729685..35729798
,35730012..35730111,35730208..35730261,35730340..35730435

Expression

GEO Profiles:Os02g0813500

Genome Context

<gbrowseImage1> name=NC_008395:35724714..35730696 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:35724714..35730696 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggctaggaagatgctcaaggacgaggaggtggaggtggccgtcaccgacggcgggagctacgactacgacctgttcgtgatcggcgccgggagcggcggcgtccggggctctcgcacctccgcgtccttcggggctaaggttgcgatttgcgagctcccgttccatcccatcagctcggattggcaaggagggcatggtgggacgtgtgtgatacgtggttgtgtgcctaaaaagatactggtgtatggttcatctttccgcggagaatttgaggatgcaaagaattttgggtgggaaatcaatggggacattaacttcaactggaaaaggctgctggaaaataagactcaagaaattgttagactaaatggagtataccagaggattcttggcaattctggtgtgacaatgattgaaggggcaggcagtttggttgatgctcatacagttgaagtcacaaagccagatggttcaaagcaaagatatacagcaaagcacatattgatagcaactggtagccgagctcaacgtgtcaacattcctgggaaggagttagctattacttcagatgaggccttaagtttggaggagctaccaaaacgtgctgtaatccttggtggcggatatattgctgttgaatttgcttctatatggaaagggatgggtgcgcacgtagacttgttttatcgaaaagagcttcctctaagaggtttcgatgatgagatgaggacggttgttgcaagtaaccttgagggaaggggaatcagattacatccagggacaaatctatctgagttgagtaaaacagccgatggcataaaagttgtcactgacaaaggagaggagatcattgcagatgttgttctgtttgctacaggtcgcacaccaaactcccagaggttgaacttggaagctgctggtgttgaagttgataatattggagctataaaggttgatgattattctcgtacatcagtcccaaatatatgggctgtgggtgatgtaacgaaccggataaatttaacacctgttgcactgatggaggctacctgcttttctaaaactgtgtttggtggccagccaactaaacctgattacagagatgtaccttgtgctgttttctccatcccaccactatcagtagtgggcttgagtgaacagcaggctttggaggaagccaagagcgatgttcttgtttacacttccagcttcaacccaatgaagaacagcatatccaaacggcaggagaagaccgtcatgaaactggtggttgattcagagactgataaagtacttggtgcatcaatgtgtggaccagatgcaccagagattatccagggtatggctgtagcgctgaagtgtggagccaccaaggcgacctttgacagcactgttggtattcacccgtctgctgctgaagagtttgtgacaatgcggaccttgaccaggcgcgtgagcccatcatccaagccaaagacaaacttgtag</cdnaseq>

Protein Sequence

<aaseq>MARKMLKDEEVEVAVTDGGSYDYDLFVIGAGSGGVRGSRTSASF GAKVAICELPFHPISSDWQGGHGGTCVIRGCVPKKILVYGSSFRGEFEDAKNFGWEIN GDINFNWKRLLENKTQEIVRLNGVYQRILGNSGVTMIEGAGSLVDAHTVEVTKPDGSK QRYTAKHILIATGSRAQRVNIPGKELAITSDEALSLEELPKRAVILGGGYIAVEFASI WKGMGAHVDLFYRKELPLRGFDDEMRTVVASNLEGRGIRLHPGTNLSELSKTADGIKV VTDKGEEIIADVVLFATGRTPNSQRLNLEAAGVEVDNIGAIKVDDYSRTSVPNIWAVG DVTNRINLTPVALMEATCFSKTVFGGQPTKPDYRDVPCAVFSIPPLSVVGLSEQQALE EAKSDVLVYTSSFNPMKNSISKRQEKTVMKLVVDSETDKVLGASMCGPDAPEIIQGMA VALKCGATKATFDSTVGIHPSAAEEFVTMRTLTRRVSPSSKPKTNL</aaseq>

Gene Sequence

<dnaseqindica>290..430#533..597#751..820#1154..1225#1323..1526#2448..2521#2620..2703#3237..3324#3418..3499#3833..3906#4129..4236#4338..4402#4972..5085#5299..5398#5495..5548#5627..5722#agaaacagatccaaccaattcgctcgcttaagccgccggcaaatcaacccaaccccaaggtacggtgctcacttctctctcttctcctttcctttttttttggttgtttttagcggtggattttgggctccacgcgcgtcgcggggcggcaatcgcgtctcatcaagtgattcctcgcgctaaagttcatcggatttggattgcaagttgttgtcaatctcaggaggggctctgtttctctctgttgtgcgtgtgcgcgttagggtttttcgtgtggtgttgaggatccatggctaggaagatgctcaaggacgaggaggtggaggtggccgtcaccgacggcgggagctacgactacgacctgttcgtgatcggcgccgggagcggcggcgtccggggctctcgcacctccgcgtccttcggggctaaggtttgacttttctcctctcccccgctccccatttttgcgaggaaacgtgttggatttttattttttttcgtgtgatttgattcggtgtgtggcgcggttcaggttgcgatttgcgagctcccgttccatcccatcagctcggattggcaaggagggcatggtgggacgtaagcatctgccgattacttgtctgcgtttacatttctgtcgttgaatgcttgattatgatttaaaccaactctcctcatcccctgggtgagaatgtgagatgttgctgcatcctaaaacccgcatgctcattattgtacatgttgtgctaggtgtgtgatacgtggttgtgtgcctaaaaagatactggtgtatggttcatctttccgcggagaatttgaggtaactgatcttactaacttatggagccaactattacttgtttgaaaaacaagttggaagcattgtgtttaggttcaatgtgctgtggcttgctgaattatgttcctttactcaatttttgcaaaatttgctaagccttacagcctccatccttgatcaacagttcatcattctgcgtactgacttgaaatccaataacctatccatttgagagcttgttatcatctttttatacaaactatttcatttagcttgcttgcatctttgtgagtacatgtactgaagtgtcattctggggtgcttattggaattgctactgttgtatgattgcaggatgcaaagaattttgggtgggaaatcaatggggacattaacttcaactggaaaaggctgctggaaaataaggtcagagccgcaaccttggttgggagaacgttcctgcattattatttgctcgttataaatgcttacaacccaatattgtaaaaaccgttctctgcagactcaagaaattgttagactaaatggagtataccagaggattcttggcaattctggtgtgacaatgattgaaggggcaggcagtttggttgatgctcatacagttgaagtcacaaagccagatggttcaaagcaaagatatacagcaaagcacatattgatagcaactggtagccgagctcaacgtgtcaacattcctgggaaggtaacaaaattctctgccagcctttgcaaacttgtttcttatgtctggcaagtagttaatagcattgttacttgtttgacaacttctttatattccccaacttttgtgcctgaaacctttggattgacctcgtgatgctgatttccatgccatcttctgtatttgttgtgatactgttgcacatcaataattatttgtgatagccagtttgatatggctgaacttttagggttaatcccctttagatatttcttattacttgacccaaaatacaatactccctctattccataatataaggcacaactactttttaaagctgttccataatataaggcatacatgcatgcatgccattaactaacacatattctccactaaaatattattatttaaattctccactatcaagatctctaattttattgggtgcatgtattacatttattagattaatctaaactatgaggtgattgaaggtggttgtgccttatattttggaatggagggagtactaggctacctttatatactgaggtgcctctagataagggaaacggatacaaactattaacctgatactactaggactcttataacaaaactatgaaactctgataaggagcttattaggactttccaactgctgaagcacttgccaaatctgacttatctctattacgccgccgctgatatactataccataacgtccagccatgacacagttggtgtggatttgacattacaagacttcctttgagccagttcaagagggacaaagcattatctttaatccaacaaattatacttagccatatatatgtgctggttacatcactgattttcttttccctttagtttttttttaaatgtcctttggtgtattattttggctgacactgataagaacccgcttgcaggagttagctattacttcagatgaggccttaagtttggaggagctaccaaaacgtgctgtaatccttggtggcgggtatgtctacactctagggtgcatttatgtactatatattgttatgtcattccaactatctcagacttgcatttgttcatgtggtggctatattgcagatatattgctgttgaatttgcttctatatggaaagggatgggtgcgcacgtagacttgttttatcgaaaagagcttcctctaaggtatttattataatctgttatctgcactgtgacctccagatatttaaaattgtacaccaaaacaatttactgctcagtatcagaaaaaagaacatcaatgtagcttctgtagttgcagtttttatgtcataatgtggctagagttgatagcatggttttctagtctaactgaagcttttggtcttgttttcagggctcagtcatgtgccactttagttactgtcctattttgacaatcttaattttttgccaaccctggtggttaatactacttgatcttctcgttttgtacattgatgcaatttattttctgaacattttttttgcaatatcatcaacctacaatgaaaacatggatgatgaaactagttatcagataaaacgatgcgattgcgaagcctggaccatgctatctgaacaactgaataatgattatggagaaagaatgccaatgtcatttttattagccaaaatttcaagctattgattacggttctatccaccatgattaatggcgaattgactaattgcagaggtttcgatgatgagatgaggacggttgttgcaagtaaccttgagggaaggggaatcagattacatccagggacaaatctatctgaggtgagttaagctgacatcctaaagtgcattttgattcccatgtgttctgttttcacgataggttttgatctgtttcttttttatgtaaaccagttgagtaaaacagccgatggcataaaagttgtcactgacaaaggagaggagatcattgcagatgttgttctgtttgctacaggtatttaggatagttcaatgctgaaagttatgttctctgtcactttaataatttctttgaatacatctctcttgatgactgttctgtgctggatgaaaaaaaatcatgtatcttctgatatttcacatggtcaagcaccatatgcatgtttgaaattgatcaatgtcatcctcacaacatttttttttatctcttgttgttgggaattgagatgctcaatatgagacattctacttttcacactatatttggaatgtggcatttatcctgattttcttttctttgaaggaaactttaatattgttgctatgcctggtatttaattgcgtgcaggtcgcacaccaaactcccagaggttgaacttggaagctgctggtgttgaagttgataatattggagctataaaggttgattttcttgccttattaattgaacccttacctgttaggctgttagcttgctgaagacatatttgttcatctgaaatttacttctcgtatttccttggagaaaacttacgcgtgaacctatgtgagaccatcttaggcatttaattggccattatctttgtatgatattctttgagactacaagtaatttgtgttgtttattcaatgttctatttttaggttgatgattattctcgtacatcagtcccaaatatatgggctgtgggtgatgtaacgaaccggataaatttaacacctgttgcactgatggaggctacctgcttttctgtaagtgactacagtgactcataatccccttgtaaattgggtgtgttcaaatttctttgtttctgtgtaaccagcaactttactttaatctttaattgcagaaaactgtgtttggtggccagccaactaaacctgattacagagatgtaccttgtgctgttttctcgtaagccaataaaccttgattgttctctgttatctccagtttttgtttttaactgaaacaagtagcatctacaagatggccacatatatacttcacaactctttgcttttgacactttcggtgaggcacactgtggtttggttttcttgtctgcacttcgaatgtttatttgcttagatcttagcagtgaaagagagtagcatgacgtgatatagggtaacttttctattcttccaggtttgactgagcagcatgaaacttgtgtgcggttgttatgctggatgtttcttaattctaattgatgcctatgtagtttagggtacattaggaagtaagcaacaattaaattctacattaacaaaacatggactagaatctagatagaaaaaaaattagtcatttcaatagacaagatctaaggatccttcactagtgatttttgcttttgccagtgcttctaccaatctattattcagtgcatttatggctgctgctgctttctttagattatctgcttttccacaatcatcgtgtcactcataacatggtttctttttttgttgaattagcatcccaccactatcagtagtgggcttgagtgaacagcaggctttggaggaagccaagagcgatgttcttgtttacacttccagcttcaacccaatgaagaacagcatatccaagtaagtatcatgtttattgcaagatcatctgttacgtcatagttacacctgactcctgagtgctttatcacttgaaggttctgggtatttcattattttcacttgtcatggtctcatggaccataaacattctagtaatggagcctatcagtgtcgtcattctttatagttcctgttctggtgaagtttcctgactcggctcactttttttagacggcaggagaagaccgtcatgaaactggtggttgattcagagactgataaagtacttggtgcatcaatgtgtggaccagatgcaccagagattatccaggtaagcaaagtttgtgtgtttatttcacacacaaaaaaatcgtggcattttccagtcttcactagtattttgcacctgactttccaccaattgcagggtatggctgtagcgctgaagtgtggagccaccaaggcgacctttgacagcactgtacgtggacacaacaataaaccagttgttaatatcatttggcactcgagtttctaatattatccattggctttgcaggttggtattcacccgtctgctgctgaagagtttgtgacaatgcggaccttgaccaggcgcgtgagcccatcatccaagccaaagacaaacttgtaggcaagatgagtaattttggataaagaaacatatatacccgttttgatttatattttgtggcaaagtgtactctggtttgcatctggtaatttcacgttagggattctacctggaacggtaaaaaggagacaatgtatacttgattgaaataaggtttctgcatatcagcctgtacagagagtaaaacttctgcgtttttctgatccaaataagcgggcgggacatcattcgttctgcctgcagacaaactctctgaatatc</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0813500, RefSeq:Os02g0813500