Difference between revisions of "Os01g0759400"
| Line 1: | Line 1: | ||
| − | + | '''''OsCIPK12''''' is a number of '''CIPK genes''' (CIPKs,calcineurin B-like protein interacting protein kinases)<ref name="ref1"/>. | |
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | *''OsCIPK12''-overexpressing transgenic plants '''accumulated significantly higher contents of proline''' and '''soluble sugars''' than the wild type. Putative proline synthetase and transporter genes had significantly higher expression level in the transgenic plants than in the wild type. The differentially induced expression of ''OsCIPK'' genes by different stresses and the examples of improved stress tolerance of the ''OsCIPK'' transgenic rice suggest that rice CIPK genes have diverse roles in different stress responses and some of them may possess potential usefulness in stress-tolerance improvement of rice<ref name="ref1"/>. | |
| + | |||
| + | *[[Os03g0634400|''OsCIPK07'']], [[Os03g0339900|''OsCIPK10'']], ''OsCIPK12'', and [[Os12g0113500|''OsCIPK14'']] showed a similar diurnal pattern to ''OsGI'' and the others were similar to those of ''OsLHY''<ref name="ref2"/>. | ||
| + | |||
| + | *Interestingly, five ''OsCIPK'' genes, [[Os01g0292200|''OsCIPK1'']], [[Os07g0678600|''OsCIPK2'']], [[Os03g0339900|''OsCIPK10'']], ''OsCIPK11'' and ''OsCIPK12'', were transcriptionally '''up-regulated''' after '''bacterial blight infection'''<ref name="ref1"/><ref name="ref3"/>. | ||
| + | |||
| + | '''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0004672 GO:0004672],[http://amigo.geneontology.org/amigo/term/GO:0004674 GO:0004674], [http://amigo.geneontology.org/amigo/term/GO:0006468 GO:0006468], [http://amigo.geneontology.org/amigo/term/GO:0005524 GO:0005524], [http://amigo.geneontology.org/amigo/term/GO:0007165 GO:0007165] | ||
| + | |||
| + | ===Mutation=== | ||
| + | [[File: OsCIPK12 overexpressing1.png|right|thumb|270px|'''Figure 1.''' dentification and drought-tolerance testing of OsCIPK12-overexpressing rice.(from reference <ref name="ref1"/>).'']] | ||
| + | *A total of 27 independent transgenic plants were generated for the ''OsCIPK12'' overexpression construct. Among them, 15 plants showed overexpression of the gene, as determined by RNA gel-blot analysis (Fig. 1A). | ||
| + | *At least 20 hygromycin-resistant transgenic seedlings with similar plant height and vigor as the wild type (Fig. 1B) for each of six ''OsCIPK12''-overexpressed T<sub>1</sub> families were selected for drought-resistance testing at the vegetative stage<ref name="ref1"/>. | ||
| + | |||
| + | *Under drought stress, ''OsCIPK12''-overexpressing plants (three independent lines were tested) '''accumulated Pro and soluble sugars''' much '''quicker''' than wild-type plants. After water withholding for 6 d, transgenic plants accumulated approximately 7-fold higher content of Pro and 5-fold higher content of soluble sugars compared to the contents of Pro and sugars before drought stress. Such increases were significantly higher than that in wild-type plants, in which Pro and soluble sugars were increased less than 3-fold after drought stress<ref name="ref1"/>. | ||
===Expression=== | ===Expression=== | ||
| − | + | *With water withheld for 1 week, only a few plants of the transgenic families showed slight leaf-rolling, while almost all leaves of the wild type became rolled or withered.After recovery for 3 d, only about 30% of wild-type plants survived, whereas most of the transgenic plants (62.7% to 87.4%) survived quite well (Fig. 1C)<ref name="ref1"/>. | |
| + | |||
| + | *The survival rates of the six transgenic families were significantly higher than the survival rate of the wild type (Fig. 1D)<ref name="ref1"/>. | ||
| + | |||
| + | *Overexpression of ''OsCIPK12'' could '''increase the drought tolerance''' of rice at the vegetative stage. ''Xiang et al.'' also '''tested the salt and cold tolerance''' of ''OsCIPK12'' transgenic plants, '''but no significant effect''' on improving tolerance to these two stresses was detected (data not shown)<ref name="ref1"/>. | ||
| + | |||
| + | *By the RT-PCR-based cDNA cloning approach, '''15''' CIPK genes were cloned from stress-treated seedlings of Nipponbare. Among them, '''10''' genes ([[Os07g0678600|''OsCIPK2'']], [[Os01g0206700|''OsCIPK5'']], [[Os03g0339900|''OsCIPK10'']], ''OsCIPK11'', ''OsCIPK12'', [[Os12g0113500|''OsCIPK14'']], [[Os11g0113700|''OsCIPK15'']], [[OOs05g0332300|''OsCIPK18'']], [[Os06g0543400|''OsCIPK25'']] and [[Os02g0161000|''OsCIPK26'']]) were '''intron-less''', and other '''five''' genes ([[Os01g0292200|''OsCIPK1'']], [[Os03g0319400|''OsCIPK3'']], [[Os03g0634400|''OsCIPK7'']], [[Os07g0150700|''OsCIPK23'']] and [[Os06g0606000|''OsCIPK24'']]) were '''intron-rich''', consistent with the previous data<ref name="ref1"/><ref name="ref3"/>. | ||
| + | |||
| + | *''OsCIPK12'':''OsCIPK30'' is tandem duplication<ref name="ref1"/>. The pair of genes (''OsCIPK30'':''OsCIPK12'') depicting neo-functionalization because expression pattern was very divergent, exactly opposite for most of the tissue and condition tested<ref name="ref4"/>. | ||
===Evolution=== | ===Evolution=== | ||
| − | + | There are '''four numbers''' in subgroup IV: ''OsCIPK12'', ''OsCIPK13'', ''Os-CIPK19'', and ''OsCIPK25''. In '''subgroup IV''', ''OsCIPK12'' and ''OsCIPK19'' were the candidate genes showing '''circadian regulation''', and in the WT both genes showed redundant circadian expression patterns<ref name="ref2"/>. | |
| + | |||
| + | ===Knowledge Extension=== | ||
| + | *Calcineurin B-like protein-interacting protein kinases(CIPKs) are a group of typical Ser/Thr protein kinases that mediate calcium signals. Some genes in the CIPK family of rice are involved in the responses to multiple abiotic stresses, whereas some genes of the family are responsive to specific stresses<ref name="ref1"/>. | ||
| − | + | *The calcineurin B-like protein–CBL-interacting protein kinase ('''CBL–CIPK''') signaling pathway in plants is a Ca<sup>2+</sup>-related pathway that responds strongly to both abiotic and biotic environmental stimuli. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells<ref name="ref5"/>. | |
| + | |||
| + | *As a plant-specific Ca<sup>2+</sup> sensor relaying pathway, the CBL–CIPK pathway has some crosstalk with other signaling pathways. In addition, research has shown that there is crosstalk between the CBL–CIPK pathway and the low-K<sup>+</sup> response pathway, the ABA signaling pathway, the nitrate sensing and signaling pathway, and others<ref name="ref5"/>. | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
| − | + | *National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China | |
| − | + | *Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea | |
| + | *Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea | ||
| + | |||
==References== | ==References== | ||
| − | + | <references> | |
| + | * <ref name="ref1"> | ||
| + | Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428. | ||
| + | </ref> | ||
| + | * <ref name="ref2"> | ||
| + | Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68. | ||
| + | </ref> | ||
| + | * <ref name="ref3"> | ||
| + | CHEN X, GU Z, LIU F, et al. Molecular Analysis of Rice CIPKs Involved in Biotic and Abiotic Stress Responses[J]. Chinese Journal of Rice Science, 2010, 6: 003. | ||
| + | </ref> | ||
| + | * <ref name="ref4"> | ||
| + | Kanwar P, Sanyal S K, Tokas I, et al. Comprehensive structural, interaction and expression analysis of CBL and CIPK complement during abiotic stresses and development in rice[J]. Cell Calcium, 2014. | ||
| + | </ref> | ||
| + | * <ref name="ref5"> | ||
| + | Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J]. Plant cell reports, 2014, 33(2): 203-214. | ||
| + | </ref> | ||
| + | </references> | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 13:21, 28 January 2015
OsCIPK12 is a number of CIPK genes (CIPKs,calcineurin B-like protein interacting protein kinases)[1].
Contents
Annotated Information
Function
- OsCIPK12-overexpressing transgenic plants accumulated significantly higher contents of proline and soluble sugars than the wild type. Putative proline synthetase and transporter genes had significantly higher expression level in the transgenic plants than in the wild type. The differentially induced expression of OsCIPK genes by different stresses and the examples of improved stress tolerance of the OsCIPK transgenic rice suggest that rice CIPK genes have diverse roles in different stress responses and some of them may possess potential usefulness in stress-tolerance improvement of rice[1].
- OsCIPK07, OsCIPK10, OsCIPK12, and OsCIPK14 showed a similar diurnal pattern to OsGI and the others were similar to those of OsLHY[2].
- Interestingly, five OsCIPK genes, OsCIPK1, OsCIPK2, OsCIPK10, OsCIPK11 and OsCIPK12, were transcriptionally up-regulated after bacterial blight infection[1][3].
GO assignment(s): GO:0004672,GO:0004674, GO:0006468, GO:0005524, GO:0007165
Mutation
- A total of 27 independent transgenic plants were generated for the OsCIPK12 overexpression construct. Among them, 15 plants showed overexpression of the gene, as determined by RNA gel-blot analysis (Fig. 1A).
- At least 20 hygromycin-resistant transgenic seedlings with similar plant height and vigor as the wild type (Fig. 1B) for each of six OsCIPK12-overexpressed T1 families were selected for drought-resistance testing at the vegetative stage[1].
- Under drought stress, OsCIPK12-overexpressing plants (three independent lines were tested) accumulated Pro and soluble sugars much quicker than wild-type plants. After water withholding for 6 d, transgenic plants accumulated approximately 7-fold higher content of Pro and 5-fold higher content of soluble sugars compared to the contents of Pro and sugars before drought stress. Such increases were significantly higher than that in wild-type plants, in which Pro and soluble sugars were increased less than 3-fold after drought stress[1].
Expression
- With water withheld for 1 week, only a few plants of the transgenic families showed slight leaf-rolling, while almost all leaves of the wild type became rolled or withered.After recovery for 3 d, only about 30% of wild-type plants survived, whereas most of the transgenic plants (62.7% to 87.4%) survived quite well (Fig. 1C)[1].
- The survival rates of the six transgenic families were significantly higher than the survival rate of the wild type (Fig. 1D)[1].
- Overexpression of OsCIPK12 could increase the drought tolerance of rice at the vegetative stage. Xiang et al. also tested the salt and cold tolerance of OsCIPK12 transgenic plants, but no significant effect on improving tolerance to these two stresses was detected (data not shown)[1].
- By the RT-PCR-based cDNA cloning approach, 15 CIPK genes were cloned from stress-treated seedlings of Nipponbare. Among them, 10 genes (OsCIPK2, OsCIPK5, OsCIPK10, OsCIPK11, OsCIPK12, OsCIPK14, OsCIPK15, OsCIPK18, OsCIPK25 and OsCIPK26) were intron-less, and other five genes (OsCIPK1, OsCIPK3, OsCIPK7, OsCIPK23 and OsCIPK24) were intron-rich, consistent with the previous data[1][3].
- OsCIPK12:OsCIPK30 is tandem duplication[1]. The pair of genes (OsCIPK30:OsCIPK12) depicting neo-functionalization because expression pattern was very divergent, exactly opposite for most of the tissue and condition tested[4].
Evolution
There are four numbers in subgroup IV: OsCIPK12, OsCIPK13, Os-CIPK19, and OsCIPK25. In subgroup IV, OsCIPK12 and OsCIPK19 were the candidate genes showing circadian regulation, and in the WT both genes showed redundant circadian expression patterns[2].
Knowledge Extension
- Calcineurin B-like protein-interacting protein kinases(CIPKs) are a group of typical Ser/Thr protein kinases that mediate calcium signals. Some genes in the CIPK family of rice are involved in the responses to multiple abiotic stresses, whereas some genes of the family are responsive to specific stresses[1].
- The calcineurin B-like protein–CBL-interacting protein kinase (CBL–CIPK) signaling pathway in plants is a Ca2+-related pathway that responds strongly to both abiotic and biotic environmental stimuli. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells[5].
- As a plant-specific Ca2+ sensor relaying pathway, the CBL–CIPK pathway has some crosstalk with other signaling pathways. In addition, research has shown that there is crosstalk between the CBL–CIPK pathway and the low-K+ response pathway, the ABA signaling pathway, the nitrate sensing and signaling pathway, and others[5].
Labs working on this gene
- National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China
- Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
- Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea
References
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
- ↑ 2.0 2.1 Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
- ↑ 3.0 3.1 CHEN X, GU Z, LIU F, et al. Molecular Analysis of Rice CIPKs Involved in Biotic and Abiotic Stress Responses[J]. Chinese Journal of Rice Science, 2010, 6: 003.
- ↑ Kanwar P, Sanyal S K, Tokas I, et al. Comprehensive structural, interaction and expression analysis of CBL and CIPK complement during abiotic stresses and development in rice[J]. Cell Calcium, 2014.
- ↑ 5.0 5.1 Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J]. Plant cell reports, 2014, 33(2): 203-214.
Structured Information
| Gene Name |
Os01g0759400 |
|---|---|
| Description |
OsPK7 |
| Version |
NM_001050846.1 GI:115440062 GeneID:4325613 |
| Length |
5052 bp |
| Definition |
Oryza sativa Japonica Group Os01g0759400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:33699375..33704426 |
| Sequence Coding Region |
33700652..33700715,33702779..33704337 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:33699375..33704426 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:33699375..33704426 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgctgatggcgaccgtctcgccggcgcggagggagccgacgccgcaggcggtgcgggcgtccccgatgccatcggcggcggcggcgttggtgaggagaggcggtggtggtagcggggggacggtgctggggaagtacgagctggggcgcgtcctgggacagggctcgttcgcgaaggtgtaccaggcgaggcacctggagaccgacgagtgcgtggcaatcaaggtgctcgacaaggagaaggccgtgaagggcgggatggtccacctcgtcaagcgcgagatcaacgtgctccgccgggtgcgccacccgaacatcgtgcagctgttcgaggtaatggccagcaagaccaagatctacttcgtcatggagtatgtccgcggcggcgagctcttctcccgcgtctccaagggacgcctcagggaggacaccgcgcggcgctacttccagcagcttgtctccgccgtcgacttctgccacgcccgcggcgtgttccaccgtgacctcaagcccgagaacctcctcgtggatgagaacggggacttgaaggtctcggacttcggcctcgccgccggccccgaccagttcgaccccgacggtctgctccacacgttctgcggcacgccggcctacgtcgcccccgaggtgctcaggcgccgcggatacgacggcgccaaggcggacatatggtcatgcggtgtcatcctctttgcgctcatggccgggtacctccctttccatgaccacaacatcatggttctgtaccggaagatctacaatggggagttcaggtgtccaaggtggttctccaaggattttactagattgataacgcgccttcttgacgcaaaccccaaaactaggatcaccgtgccagagatcattgagagcgattggttcaagaaaggatacaagccagtcaagttttacattgaggatgacaagctctacaacctgtctgatgacgtgctgaacttggagcctgctgatcctgttcccccaccattgggtttggcacctcctgttcctccacctccacaaggggatgatcctgatggttcagggtctgagtcagattcatcagtcgtatcctgcccggccacattgtcaactggggagagccagagagtccgtgggtcactaccacgcccagcaagccttaatgcatttgatatcatatcattctcaaaaggattcaacttgtctgggctgtttgaggagagggggaacgagatcaggtttgtatctggtgagcccatgtctgacattgtaaaaaagctggaggagattgcaaaggtcaagagcttcacagtgcggaggaaggactggcgggtgagcatagagggtacacgcgaaggagttaaggggcctctaaccataggcgcggagatatttgagcttacaccctcccttgtagtagtggaagtaaaaagaaaggcaggtgataatgaagagtatgaggatttctgcaacatggagttgaagccaggaatgcagcaccttgtgcaccagatgctcccagctccaaatggaactcctgtgagtgagaaggttgaaaggtcttcaagcttacaggctcccctcaccctgaagttgataggaacagaaggcagcatgagctag</cdnaseq> |
| Protein Sequence |
<aaseq>MLMATVSPARREPTPQAVRASPMPSAAAALVRRGGGGSGGTVLG KYELGRVLGQGSFAKVYQARHLETDECVAIKVLDKEKAVKGGMVHLVKREINVLRRVR HPNIVQLFEVMASKTKIYFVMEYVRGGELFSRVSKGRLREDTARRYFQQLVSAVDFCH ARGVFHRDLKPENLLVDENGDLKVSDFGLAAGPDQFDPDGLLHTFCGTPAYVAPEVLR RRGYDGAKADIWSCGVILFALMAGYLPFHDHNIMVLYRKIYNGEFRCPRWFSKDFTRL ITRLLDANPKTRITVPEIIESDWFKKGYKPVKFYIEDDKLYNLSDDVLNLEPADPVPP PLGLAPPVPPPPQGDDPDGSGSESDSSVVSCPATLSTGESQRVRGSLPRPASLNAFDI ISFSKGFNLSGLFEERGNEIRFVSGEPMSDIVKKLEEIAKVKSFTVRRKDWRVSIEGT REGVKGPLTIGAEIFELTPSLVVVEVKRKAGDNEEYEDFCNMELKPGMQHLVHQMLPA PNGTPVSEKVERSSSLQAPLTLKLIGTEGSMS</aaseq> |
| Gene Sequence |
<dnaseqindica>3712..3775#90..1648#ggtacagagcagaggaggggggagagagagagagagagagagagagagagagtcgtgtgtgcgtgtgtccccggggttctagctttgggatgctgatggcgaccgtctcgccggcgcggagggagccgacgccgcaggcggtgcgggcgtccccgatgccatcggcggcggcggcgttggtgaggagaggcggtggtggtagcggggggacggtgctggggaagtacgagctggggcgcgtcctgggacagggctcgttcgcgaaggtgtaccaggcgaggcacctggagaccgacgagtgcgtggcaatcaaggtgctcgacaaggagaaggccgtgaagggcgggatggtccacctcgtcaagcgcgagatcaacgtgctccgccgggtgcgccacccgaacatcgtgcagctgttcgaggtaatggccagcaagaccaagatctacttcgtcatggagtatgtccgcggcggcgagctcttctcccgcgtctccaagggacgcctcagggaggacaccgcgcggcgctacttccagcagcttgtctccgccgtcgacttctgccacgcccgcggcgtgttccaccgtgacctcaagcccgagaacctcctcgtggatgagaacggggacttgaaggtctcggacttcggcctcgccgccggccccgaccagttcgaccccgacggtctgctccacacgttctgcggcacgccggcctacgtcgcccccgaggtgctcaggcgccgcggatacgacggcgccaaggcggacatatggtcatgcggtgtcatcctctttgcgctcatggccgggtacctccctttccatgaccacaacatcatggttctgtaccggaagatctacaatggggagttcaggtgtccaaggtggttctccaaggattttactagattgataacgcgccttcttgacgcaaaccccaaaactaggatcaccgtgccagagatcattgagagcgattggttcaagaaaggatacaagccagtcaagttttacattgaggatgacaagctctacaacctgtctgatgacgtgctgaacttggagcctgctgatcctgttcccccaccattgggtttggcacctcctgttcctccacctccacaaggggatgatcctgatggttcagggtctgagtcagattcatcagtcgtatcctgcccggccacattgtcaactggggagagccagagagtccgtgggtcactaccacgcccagcaagccttaatgcatttgatatcatatcattctcaaaaggattcaacttgtctgggctgtttgaggagagggggaacgagatcaggtttgtatctggtgagcccatgtctgacattgtaaaaaagctggaggagattgcaaaggtcaagagcttcacagtgcggaggaaggactggcgggtgagcatagagggtacacgcgaaggagttaaggggcctctaaccataggcgcggagatatttgagcttacaccctcccttgtagtagtggaagtaaaaagaaaggcaggtgataatgaagagtatgaggatttctgcaacatggagttgaagccaggaatgcagcaccttgtgcaccagatgctcccagctccaaatggaactcctgtgagtgagaaggttgaaaggtaatgattctctcctgattttacttatatgcattgtagctaaatagggaagcaaggattttgtgttgtttaacatgcgcaaccgggcagaaagttaaattgattgatgcttcagttccaataattacataacaatgtttcacttcttgactatacatcctgtatttcaaattgagcgttcaagagtttgtttgctaaaagttaattgatttttattcatgctatttgtttttgttaacgtatgtttaattcacaatcatgcctattgcctaataccagtatgtagaaggaattagatttccttgcacggacacaatttaaagtaggaaagccttgcaattgaaaacctcgaacaactggaacttttattatttctagagtggtgaaagaatgctataggttttgctgttagattttgccaaccattaactagcttgcctcctgcaatccaatttcacagcgcttggataatgcgtatgtctggaaatttgctgccacttgaccattgcaagtgtgcttcgtgaaaagaagcaaatttgaatggttctaatcatcctagtttgtggctgttaaactgattatagattgttttgtttcattctagagcatgatttggtttatctaacatctgtgctcttttaatctatgctacgaactcaatttttcgtaaaatctttcccgcaccctattcttatggactttttagcttgtgatagattgtataagataaatgtcttttctagtcatcagttaatgaaaacattttcgcttgtcttatctatcttttggagttactttaaaaagtgattatgcactgttctactgcaccttagcttgtaaacttcctgctcttatttatttttctttatgtttccattttttttggataatggaattcaatccagtattgatgatgattccatgttaccccagcatttattggtgttgaatgtttacatgtgtcataattcatattgaaaaaacttttgaaaacaaatatagaaaggaaccgccaatatcatgtccttctggtttccccattgttgttatcaccaacttccatggattggcattgtgctgcacatcagcatatgggatagaatgggagcttgaagggaatgcttggcagtacctccgagtaccgaaatgtcatttttacaaagaacatgtgcttcactagattttcagcatgctaggtaaatgttgaaagtgctgtataggtttattatctggtgtagctccctctgacatagtaataacaggttgctttatgggaaacctggtagattttatctatttaatttggtgaaaccatgaaaatgcaaacatcatggctgagacattgaaaattacaaaacagaaagggcgcatagcaacaccatatactattcatgcaaaccatttctactattttaacctgtgagtttttgatggtttctagtttctttttacattcaaatgggctctaattcctgattttaggaggttcctttcttttcagtttcattgctgttattgataaattatcttttttttcattaatgataactttatactttgatggatctttgttgaacacttaatctggtgcacatgttagccacccaccattataggagaacacatgggacacatttaccttcagaggtaaggagggttatgtgcgtaagctgtgcctcggaggtagataggtgtgtttccagaagactttttgttacatttgtcaacctaattttcctccatcggagtagtacattctgtactgcgcaatactagcatcagttaggaaagttggttcaaatatgctccatggtacgtgggtgtacctggagctgttctgtagtcttgttttgaatcttcaatttaccttgaagaattttgcttttgccagtgaactgttatagtccatttgaattgtttgaaatgctactacaaccggaaactattgctttggttctcatagttcagaactcaataggaaatagaagtctattgctgttattacatacaagtgtgataagactaacagactgacatttgattatttccttcttgtcctgcaggtcttcaagcttacaggctcccctcaccctgaagttgataggaacagaaggcagcatgagctagagacaggagcttccatgcagttgacagggagatctcttttaccggaccaaacctgaccggtctggttcccgttgatgagctcgtggttttgataactagcaagagttctctttctctggatggcctaagatcgtttttaggcaatggatcgagacagtggatgtagatactccggttgtggatggtgcccaggtgggcgtttaaagtggatgtagataccctggttgtggtggtgcccaggtgggcgtttaaagtggattgtactggccagttttctctcgacttagcggctgtgtgcatctgcggtttggtttctttggcagcatcgaataattttgtggtaaccatgattctggtcgggggacagttgattgaggtatgggagggatatgcatgagccgggcatgtgccgaccgattggattccgaatcttccattcctgatgccattagcccattattggatgcgaggtgacagatttgggcactgcagtgcggttggttggttggggcctgtggggactgggggtcgagattacttggacctgctgtgctgcagcggctttggctgaggtcaccgagcacgtgagagcatcggtgggtggcatggttggcctaccccggcagtggtggcggccggctcgggccacgagagcgccgcgccgtttgtggtggcgcacggctctgcagtcggcggcgggcccgttgttgcgcatttccgtgataaagatcaccgtggtatgtcgtattctgttatacaatgctctttttgtggattcgaacttcgaatatggagttatggacacgggtggtcatcgatggagacaacagtggcgaaccggcgatttcatatggctcagtgagatgctttaaggtacataacaatttgaggtatgcattcatttaatcatgacatggcatgattaaccttggatttgtgtgaaagctatcactataacgacctgtactcttggtgatattccccaccgtgccaatttcctggtatctacactcctcaacggatatgtcgtggaaatgcagcatttctaacccaacagatacagggatcatatttcatcctacaaagattatgtgaaagagatcagcataataatggaaatacgcttaaaaagtaaaatcatgaaaattccatgtgatagttaggatcgacaatgacaatgattataatcatatcacaatataagatatagcctattgtaatataagaatttgatgctctgttttataatgttactacctctttacttcttgtttttg</dnaseqindica> |
| External Link(s) |