Difference between revisions of "Os01g0292200"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
+
'''''OsCIPK1''''' is a number of '''CIPK genes''' (CIPKs,calcineurin B-like protein interacting protein kinases)<ref name="ref1"/>.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
*Interestingly, five ''OsCIPK'' genes, ''OsCIPK1'', [[Os07g0678600|''OsCIPK2'']], [[Os03g0339900|''OsCIPK10'']], ''OsCIPK11'' and [[Os01g0759400|''OsCIPK12'']], were transcriptionally '''up-regulated''' after '''bacterial blight infection'''<ref name="ref1"/><ref name="ref2"/>.
 +
 
 +
*''OsCIPK1'' is involved in the biotic stress<ref name="ref1"/>. 
 +
*''OsCBL7'' and ''OsCBL8'' interact strongly with ''OsCIPK1''. ''OsCBL1'' interacted strongly with ''OsCIPK1''<ref name="ref3"/>. 
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
*By the RT-PCR-based cDNA cloning approach, '''15''' CIPK genes were cloned from stress-treated seedlings of Nipponbare. Among them, '''10''' genes ([[Os07g0678600|''OsCIPK2'']], [[Os01g0206700|''OsCIPK5'']], [[Os03g0339900|''OsCIPK10'']], ''OsCIPK11'', [[Os07g0678600|''OsCIPK2'']], [[Os12g0113500|''OsCIPK14'']], [[Os11g0113700|''OsCIPK15'']], [[OOs05g0332300|''OsCIPK18'']], [[Os06g0543400|''OsCIPK25'']] and [[Os02g0161000|''OsCIPK26'']]) were '''intron-less''', and other '''five''' genes (''OsCIPK1'', [[Os03g0319400|''OsCIPK3'']], [[Os03g0634400|''OsCIPK7'']], [[Os07g0150700|''OsCIPK23'']] and [[Os06g0606000|''OsCIPK24'']]) were '''intron-rich''', consistent with the previous data<ref name="ref1"/><ref name="ref2"/>.
 +
 
 +
*''OsCIPK1'' was transcriptionally up-regulated by Hg<sup>2+</sup>, the up-regulation occurred mainly in '''roots'''<ref name="ref2"/>.
 +
 
 +
*''OsCIPK01'' and ''OsCIPK33'' showed high expression in all tissues/organs except for the root, callus, and pollen<ref name="ref4"/>.
  
 +
*''OsCIPK01'' was '''induced''' by '''drought''', '''PEG treatment''' and '''cold'''<ref name="ref1"/>.
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
''OsCIPK1'' and ''OsCIPK17'', share '''78.5%''' of '''sequence identity'''<ref name="ref2"/>. ''OsCIPK01'' belongs to '''subgroup I'''<ref name="ref4"/>.
 +
 
 +
===Knowledge Extension===
 +
*Calcineurin B-like protein-interacting protein kinases(CIPKs) are a group of typical Ser/Thr protein kinases that mediate calcium signals. Some genes in the CIPK family of rice are involved in the responses to multiple abiotic stresses, whereas some genes of the family are responsive to specific stresses<ref name="ref1"/>.
  
You can also add sub-section(s) at will.
+
*The calcineurin B-like protein–CBL-interacting protein kinase ('''CBL–CIPK''') signaling pathway in plants is a Ca<sup>2+</sup>-related pathway that responds strongly to both abiotic and biotic environmental stimuli. The CBL–CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells<ref name="ref4"/>.
 +
 
 +
*Putative proline synthetase and transporter genes had significantly higher expression level in the transgenic plants than in the wild type<ref name="ref5"/>. The differentially induced expression of OsCIPK genes by different stresses and the examples of improved stress tolerance of the OsCIPK transgenic rice suggest that rice CIPK genes have diverse roles in different stress responses and some of them may possess potential usefulness in stress-tolerance improvement of rice<ref name="ref5"/>.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*State Key Laboratory of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing 210095, China
 +
*College of Chemistry and Life Sciences, Zhejiang Normal University, Jinhua 321004, China
 +
*National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China
 +
*Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
 +
*Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
 +
</ref>
 +
* <ref name="ref2">
 +
CHEN X, GU Z, LIU F, et al. Molecular Analysis of Rice CIPKs Involved in Biotic and Abiotic Stress Responses[J]. Chinese Journal of Rice Science, 2010, 6: 003. </ref>
 +
* <ref name="ref3">
 +
Kanwar P, Sanyal S K, Tokas I, et al. Comprehensive structural, interaction and expression analysis of CBL and CIPK complement during abiotic stresses and development in rice[J]. Cell Calcium, 2014.
 +
</ref>
 +
* <ref name="ref4">
 +
Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
 +
</ref>
 +
* <ref name="ref5">
 +
Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J]. Plant cell reports, 2014, 33(2): 203-214.
 +
</ref>
 +
</references>
 +
 
  
 
==Structured Information==
 
==Structured Information==

Revision as of 14:29, 28 January 2015

OsCIPK1 is a number of CIPK genes (CIPKs,calcineurin B-like protein interacting protein kinases)[1].

Annotated Information

Function

  • Interestingly, five OsCIPK genes, OsCIPK1, OsCIPK2, OsCIPK10, OsCIPK11 and OsCIPK12, were transcriptionally up-regulated after bacterial blight infection[1][2].
  • OsCIPK1 is involved in the biotic stress[1].
  • OsCBL7 and OsCBL8 interact strongly with OsCIPK1. OsCBL1 interacted strongly with OsCIPK1[3].

Expression

  • OsCIPK1 was transcriptionally up-regulated by Hg2+, the up-regulation occurred mainly in roots[2].
  • OsCIPK01 and OsCIPK33 showed high expression in all tissues/organs except for the root, callus, and pollen[4].
  • OsCIPK01 was induced by drought, PEG treatment and cold[1].

Evolution

OsCIPK1 and OsCIPK17, share 78.5% of sequence identity[2]. OsCIPK01 belongs to subgroup I[4].

Knowledge Extension

  • Calcineurin B-like protein-interacting protein kinases(CIPKs) are a group of typical Ser/Thr protein kinases that mediate calcium signals. Some genes in the CIPK family of rice are involved in the responses to multiple abiotic stresses, whereas some genes of the family are responsive to specific stresses[1].
  • The calcineurin B-like protein–CBL-interacting protein kinase (CBL–CIPK) signaling pathway in plants is a Ca2+-related pathway that responds strongly to both abiotic and biotic environmental stimuli. The CBL–CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells[4].
  • Putative proline synthetase and transporter genes had significantly higher expression level in the transgenic plants than in the wild type[5]. The differentially induced expression of OsCIPK genes by different stresses and the examples of improved stress tolerance of the OsCIPK transgenic rice suggest that rice CIPK genes have diverse roles in different stress responses and some of them may possess potential usefulness in stress-tolerance improvement of rice[5].

Labs working on this gene

  • State Key Laboratory of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing 210095, China
  • College of Chemistry and Life Sciences, Zhejiang Normal University, Jinhua 321004, China
  • National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China
  • Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
  • Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
  2. 2.0 2.1 2.2 2.3 CHEN X, GU Z, LIU F, et al. Molecular Analysis of Rice CIPKs Involved in Biotic and Abiotic Stress Responses[J]. Chinese Journal of Rice Science, 2010, 6: 003.
  3. Kanwar P, Sanyal S K, Tokas I, et al. Comprehensive structural, interaction and expression analysis of CBL and CIPK complement during abiotic stresses and development in rice[J]. Cell Calcium, 2014.
  4. 4.0 4.1 4.2 Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
  5. 5.0 5.1 Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J]. Plant cell reports, 2014, 33(2): 203-214.


Structured Information

Gene Name

Os01g0292200

Description

Protein kinase-like domain containing protein

Version

NM_001049327.1 GI:115436067 GeneID:4325161

Length

4582 bp

Definition

Oryza sativa Japonica Group Os01g0292200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:10670907..10675488

Sequence Coding Region

10671114..10671302,10671392..10671454,10673043..10673114,10673215..10673322,10673495..10673575
,10673660..10673713,10673801..10673926,10674019..10674225,10674337..10674438
,10674591..10674707,10674810..10674881,10674976..10675050,10675177..10675296

Expression

GEO Profiles:Os01g0292200

Genome Context

<gbrowseImage1> name=NC_008394:10670907..10675488 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:10670907..10675488 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtgaacggagaggcggaggcggagtgcacgcgggcgtcgctgctggggaggtatgagatcgggcgcacgctcggggagggcaacttcggcaaggtcaagtacgcgcgccacctcgccaccggcgcccacttcgccatcaagatcctcgaccgcaacaagatcctctccctccgcttcgacgaccagataaggagggagattgggacgctcaagctgctcaagcaccccaacgtcgtccgcctgcacgaggtggctgctagcaaaactaagatttacatggtgcttgaatatgtcaatggaggcgagctctttgacaagattgccgtaaaaggaaaactctctgaacatgaaggaaggagacttttccagcagttaatcgatgctgtgagctattgccatgataaaggtgtctaccacagagaccttaagcccgaaaatgttcttgtggatcgaagaggcaatatcaagatctctgactttggcctaagtgctttgcctcaacatcttgggaatgatggattgctgcacacaacatgtggcagccccaattatattgctcctgaggttttgcagaaccgaggttacgatggctcattgtcagatatctggtcttgtggagtaattctctatgtaatgctcgtcggataccttccctttgatgaccgaaatcttgttgtcctgtaccagaagattttcaagggggacactcaaatcccaaagtggctttcacctagtgcacgggatcttcttcgaaggattcttgaaccgaacccgatgaagaggatcaacatagcagggatcaaagagcatgagtggtttcagaaggattacactcctgttgttccatatgacgacgatgatgacaattatcttgactcagttcttccaatcaaagagcaaattgatgaagcaaagcaggaaaagcctactcatatcaatgcttttcagttgattggaatggcttctgcccttgatctttcaggtttctttgaggaagaggatgcgtctcaaagaaagataaggttcacatcaacacattcaccaaaagatttattcgacaagattgagaatgttgtgacggagatgggattccaagtccagaggggtaatagcaagctaaaggtcatgaaaaatggcaggggttcaaagaacctcaggaatccatcatcattcttggtctgtactgaggtagtcgagctcgggccatccttatatgttgtcgaattgaagaaatcccatggagatcctatattgtatagacagctatgtgagaggctatcagatgagctaggagtgtgcaagacagagcagattcagaggacggagtcgctggaggatgatctagagagcttcgacagcggatcttctctgcctggtttttga</cdnaseq>

Protein Sequence

<aaseq>MVNGEAEAECTRASLLGRYEIGRTLGEGNFGKVKYARHLATGAH FAIKILDRNKILSLRFDDQIRREIGTLKLLKHPNVVRLHEVAASKTKIYMVLEYVNGG ELFDKIAVKGKLSEHEGRRLFQQLIDAVSYCHDKGVYHRDLKPENVLVDRRGNIKISD FGLSALPQHLGNDGLLHTTCGSPNYIAPEVLQNRGYDGSLSDIWSCGVILYVMLVGYL PFDDRNLVVLYQKIFKGDTQIPKWLSPSARDLLRRILEPNPMKRINIAGIKEHEWFQK DYTPVVPYDDDDDNYLDSVLPIKEQIDEAKQEKPTHINAFQLIGMASALDLSGFFEEE DASQRKIRFTSTHSPKDLFDKIENVVTEMGFQVQRGNSKLKVMKNGRGSKNLRNPSSF LVCTEVVELGPSLYVVELKKSHGDPILYRQLCERLSDELGVCKTEQIQRTESLEDDLE SFDSGSSLPGF</aaseq>

Gene Sequence

<dnaseqindica>208..396#486..548#2137..2208#2309..2416#2589..2669#2754..2807#2895..3020#3113..3319#3431..3532#3685..3801#3904..3975#4070..4144#4271..4390#gttcattcctctccccccccccccctgaacccggccaactccggcgagagagacatagatagcgtgtgagacagtataaagatagagagggagaggtagttttttgttgccggcttgcggatttattgtaggagatcaggtcagtttcgttttcttgccggcgcggcgggcgtttgttgggtgcggcgggcggggaggagctcgtgaatggtgaacggagaggcggaggcggagtgcacgcgggcgtcgctgctggggaggtatgagatcgggcgcacgctcggggagggcaacttcggcaaggtcaagtacgcgcgccacctcgccaccggcgcccacttcgccatcaagatcctcgaccgcaacaagatcctctccctccgcttcgacgaccaggtatttgctccctctaatcccatccgcgcctcaccggaatcgctcgcgctcatcatctgtgttgttttggtttggtttgggatgttcagataaggagggagattgggacgctcaagctgctcaagcaccccaacgtcgtccgcctgcacgaggtaacgtctccactactctccgatcatcaccaccctctggctttttttctgcctctttttctcgattttctttcctggattttgtttcattctggacgagttcatcgtcaggttctcaacttccccacgagtcctgacaattttttttttcacacgagacctgacacttggccggttacctacagtagctgcttacttacaaggcaaagaaacatttcgattctagtagtttagtttaaccaccaggataaggatcaatcctcacaaactctttcttgatctcctcgcctcttttgagaagcaaactaattacgcaatgcaaaagcatcaccaccgcctcacgtcatgccacctcgccgccggcggttcacccctcgccgccgccgccgtagccgccgtcaaacttcgattgatcatcacggacagtccacgccgcgttctccgtgtgattcagcctctcgcgtgtttatacgcaacgaatgaatccatcaccggtcaatctggaacacgaattttcttctgattaaaaattttcagggagcgacaagaatttcgtcagagcttttccttctcctcatacatgacctcacgttctctctctctctctcccccccccccccccccccgaaaaatcagcaccgtgtcgaatgaaaggcgcctgatacgtccacgtcacccggattccgcgaaccgacggctccgatggaatcccccccgtatcctcacaggagcgaggggccccaccctggcgtttactcacattccttgcctgcctcttggtctacccgtcgaggcatgtggtggtgggcccggtaggccggcccctcggccctgctggagctgggcccacggtgtcagcgtcacgggctgtctctgtccgggtgcttttagcccagagtgcaacgtccccgtaagcccgggcgcgccgcaccaccaccacccaagtcacccaccgtgtgggcccagcagacttggcaacgcgcggggcccgcacacgtgtgtccggtgacggggcccaccgtgccatccttccctgtgggcccacaagaacagttagaggaggtcagggtgggggggggggggggggagggacgcatgatgaatggagatgatgggggagatgaacagtgtggtgatagaaatttgagaggagcaagcaatcaaagcatcgaactgctctcacctaacgatggcagttcttgtcatatggttgcattaccagaacggcgatgctcgtacccataatgtgacatctaagtacacaaaaacagtacataatctgatttgttggtgataacaattatggtaataatgctttttcttgagtcatatgatgcaagcagcaaggactgagaattggcaaaagtagaggttgtcatggtgcacagatatctgttgttgtcgtagtaaacgagtggtgttagcaagggaacaaaaaagacgttttgtcgttgctctttagttgaacatgcagttcttcagggaggtccatttgggtttcttgagaacagttctgatctgcgtaatttgcccagatgaagaaccagtgagtgatcatggaattgatatattgtttttcttttttcaggtggctgctagcaaaactaagatttacatggtgcttgaatatgtcaatggaggcgagctctttgacaagattgtaagatatgcaagccttgttggtgctgttgctttttcgtgtaaaaattgctcgtatcttgttaatactgatattttttttccattgctaatttttgaaggccgtaaaaggaaaactctctgaacatgaaggaaggagacttttccagcagttaatcgatgctgtgagctattgccatgataaaggtgtctaccacagagaccttaaggtacccgacataaatattttcagctttttacatgatggatgcctgagttacattctaatacgcaattgtaatcagatttattttcttgctcatactcatcgcaatcaaactaaactagagaattatatgattctcctgtgacagaattttcttctttattctactcttacagcccgaaaatgttcttgtggatcgaagaggcaatatcaagatctctgactttggcctaagtgctttgcctcaacatcttggggtatgataatgatttgattgaattttgttctatataaatcacctgttgtgcaatttgctgaatcatttgcactcccactttcagaatgatggattgctgcacacaacatgtggcagccccaattatattgctcctgaggtaataactgataactgaaaataatctgaaactagtaacatctttcatttctcctgcagatgctaattctgtagcgaatccatgcaggttttgcagaaccgaggttacgatggctcattgtcagatatctggtcttgtggagtaattctctatgtaatgctcgtcggataccttccctttgatgaccgaaatcttgttgtcctgtaccagaaggttggttgcaagataaagcatctttacaactttgctcacaaatttcaaatttcagactgtcctgatagtgcgaaattgtcatgtatctttagattttcaagggggacactcaaatcccaaagtggctttcacctagtgcacgggatcttcttcgaaggattcttgaaccgaacccgatgaagaggatcaacatagcagggatcaaagagcatgagtggtttcagaaggattacactcctgttgttccatatgacgacgatgatgacaattatcttgactcagttcttccaatcaaagaggtattcgtagttttctgaaaaactgtagaaattattaggaaactaacgagtacttgtttctcagtatttgttgatgctgaatttctgattggtaatttctgtttcttgaagcaaattgatgaagcaaagcaggaaaagcctactcatatcaatgcttttcagttgattggaatggcttctgcccttgatctttcaggtttctttgaggaagaggttcgtatgatgttttctcattctagacttctttcatacttttcagttatttatcagaacaagactatgtgtagtgtaacttacaatcttacaacaattttccgaatgaacctatcctaagctgcctggtgctaattgatggattattgcaggatgcgtctcaaagaaagataaggttcacatcaacacattcaccaaaagatttattcgacaagattgagaatgttgtgacggagatgggattccaagtccagaggggtaatagcaaggtagatataccaaggcctttttctcatcacatcatcgtattgtcagggaagaaacaacagctccagtaaaccaaaagcctaaaatcatgtttctctttgcagctaaaggtcatgaaaaatggcaggggttcaaagaacctcaggaatccatcatcattcttggtctgtactgaggtaaaatgccacagcacactcctttcttgtgcaatgtacattcaggaaggattgcatatcagctggtacttacatcatcactcttgatcttcaggtagtcgagctcgggccatccttatatgttgtcgaattgaagaaatcccatggagatcctatattgtatagacaggtaccataccaatgaacagccttactttctatcaccggcaacttcagtattctatctttcagtgattcagtgatatgtgtggtatcgcatcatctcagtagtttgtttcctgaaataattctgcagctatgtgagaggctatcagatgagctaggagtgtgcaagacagagcagattcagaggacggagtcgctggaggatgatctagagagcttcgacagcggatcttctctgcctggtttttgaagaattgccgccctggatcattttggttagagttagaggaacatgctctgttcttcatacaagcgtaggttaggatgttgtatagtgtacaaagtgagtggtgcaagttagccaccgatgtttaatataaggattgctctcttcttgcccgtctgttggcccaattctttcccataatgaaatgaaatcatc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0292200, RefSeq:Os01g0292200