Difference between revisions of "Os07g0678600"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
−
Please input one-sentence summary here.
+
'''''OsCIPK2(OsCIPK02)''''' is a member of '''CIPK genes''' (CIPKs,calcineurin B-like protein interacting protein kinases)<ref name="ref1"/><ref name="ref2"/>.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
−
Please input function information here.
+
*Interestingly, five ''OsCIPK'' genes, [[Os01g0292200|''OsCIPK1'']], ''OsCIPK2'', [[Os03g0339900|''OsCIPK10'']], ''OsCIPK11'' and [[Os01g0759400|''OsCIPK12'']], were transcriptionally '''up-regulated''' after '''bacterial blight infection'''<ref name="ref1"/><ref name="ref2"/>.
 +
 
 +
*''OsCIPK2'' was '''induced by cold and Bacterial blight'''. It is involved in the biotic stress<ref name="ref1"/>.   
 +
<br>
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0004672 GO:0004672],[http://amigo.geneontology.org/amigo/term/GO:0004674 GO:0004674], [http://amigo.geneontology.org/amigo/term/GO:0006468 GO:0006468], [http://amigo.geneontology.org/amigo/term/GO:0005524 GO:0005524], [http://amigo.geneontology.org/amigo/term/GO:0007165 GO:0007165]
  
 
===Expression===
 
===Expression===
−
Please input expression information here.
+
[[File: OsCIPK2 Expression1.png|right|thumb|250px|'''Figure 1.''' Validation of diurnal expression patterns for OsCIPK2.(from reference <ref name="ref3"/>).'']]
 +
 
 +
*By the RT-PCR-based cDNA cloning approach, '''15''' CIPK genes were cloned from stress-treated seedlings of Nipponbare. Among them, '''10''' genes ([[Os07g0678600|''OsCIPK2'']], [[Os01g0206700|''OsCIPK5'']], [[Os03g0339900|''OsCIPK10'']], ''OsCIPK11'', ''OsCIPK12'', [[Os12g0113500|''OsCIPK14'']], [[Os11g0113700|''OsCIPK15'']], [[OOs05g0332300|''OsCIPK18'']], [[Os06g0543400|''OsCIPK25'']] and [[Os02g0161000|''OsCIPK26'']]) were '''intron-less''', and other '''five''' genes ([[Os01g0292200|''OsCIPK1'']], [[Os03g0319400|''OsCIPK3'']], [[Os03g0634400|''OsCIPK7'']], [[Os07g0150700|''OsCIPK23'']] and [[Os06g0606000|''OsCIPK24'']]) were '''intron-rich''', consistent with the previous data<ref name="ref1"/><ref name="ref2"/>.
 +
 
 +
 
 +
*''OsCIPK2'' was up-regulated in both roots and shoots, it was also up-regulated in leaves of treated plants. ''OsCIPK2'' was highly expressed 12 h after inoculation with PXO99, clearly indicating that it was '''probably''' involved in the early events of '''rice disease response'''<ref name="ref1"/>. 
 +
 
 +
*''OsCIPK02'' showed ubiquitous expression in all tissues/organs<ref name="ref3"/>, ''OsCIPK02'' containing DRE in their promoter regions was actually '''induced by drought'''<ref name="ref2"/>. 
 +
 
 +
*Real-time RT-PCR analysis confirmed the diurnal expression patterns showing a peak at daytime and a downregulation in the ''osgi'' mutant for the three marker genes and nine of the ''OsCIPK'' genes, ''OsCIPK02'' is a member of these nine genes (Fig. 1), which indicating that ''OsCIPK02'' might function downstream of ''OsGI''<ref name="ref3"/>.  
  
 
===Evolution===
 
===Evolution===
−
Please input evolution information here.
+
''OsCIPK02'' belongs to '''subgroup III''', the others are: ''OsCIPK05'', ''OsCIPK10'', ''OsCIPK11'', ''OsCIPK14'', ''OsCIPK15'', ''OsCIPK18'', ''OsCIPK20'', ''OsCIPK26'', and ''OsCIPK28''<ref name="ref3"/>.       
 +
 
 +
===Knowledge Extension===
 +
[[File: OsCIPK family Functional.png|right|thumb|300px|'''Figure 1.''' ''Functional gene network analysis of OsCIPK family members.(from reference <ref name="ref3"/>).'']] 
 +
*From real-time RT-PCR analyses, ''Giong et al.'' identified 16 OsCIPK genes showing a significant up- or down-regulation in response to '''drought stress'''. Using the probable functional gene network tool, RiceNet, ''Giong et al.'' generated a hypothetical functional gene network based on 15 out of 16 OsCIPK proteins (Fig. 2)<ref name="ref3"/>.
 +
*More than 200 interactions mediated by these OsCIPK proteins. This network was further refined by integrating fold change data showing at least 1 log2-fold up-regulation (red colored nodes in Fig. 2) or less than -1 log2-fold down-regulation (green colored nodes in Fig. 2) under drought stress to all the elements in this network<ref name="ref3"/>.
 +
*Integrated subcellular localization data further enhances the feasibility of functional
 +
modules consisting of co-expressed functional groups such as CIPK and PPC and other components in the network(Fig. 1)<ref name="ref3"/>.
  
−
You can also add sub-section(s) at will.
+
*The calcineurin B-like protein–CBL-interacting protein kinase ('''CBL–CIPK''') signaling pathway in plants is a Ca<sup>2+</sup>-related pathway that responds strongly to both abiotic and biotic environmental stimuli<ref name="ref4"/>. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells<ref name="ref4"/>.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
−
Please input related labs here.
+
*National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China
 +
*Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
 +
*Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea
 +
*State Key Laboratory of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing 210095, China
 +
*College of Chemistry and Life Sciences, Zhejiang Normal University, Jinhua 321004, China
  
 
==References==
 
==References==
−
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
CHEN X, GU Z, LIU F, et al. Molecular Analysis of Rice CIPKs Involved in Biotic and Abiotic Stress Responses[J]. Chinese Journal of Rice Science, 2010, 6: 003.
 +
</ref>
 +
* <ref name="ref2">
 +
Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
 +
</ref>
 +
* <ref name="ref3">
 +
Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
 +
</ref>
 +
* <ref name="ref4">
 +
Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J]. Plant cell reports, 2014, 33(2): 203-214.
 +
</ref>
 +
* <ref name="ref5">
 +
 
 +
</ref>
 +
* <ref name="ref6">
 +
 
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 16:28, 28 January 2015

OsCIPK2(OsCIPK02) is a member of CIPK genes (CIPKs,calcineurin B-like protein interacting protein kinases)[1][2].

Annotated Information

Function

  • Interestingly, five OsCIPK genes, OsCIPK1, OsCIPK2, OsCIPK10, OsCIPK11 and OsCIPK12, were transcriptionally up-regulated after bacterial blight infection[1][2].
  • OsCIPK2 was induced by cold and Bacterial blight. It is involved in the biotic stress[1].


GO assignment(s): GO:0004672,GO:0004674, GO:0006468, GO:0005524, GO:0007165

Expression

Figure 1. Validation of diurnal expression patterns for OsCIPK2.(from reference [3]).


  • OsCIPK2 was up-regulated in both roots and shoots, it was also up-regulated in leaves of treated plants. OsCIPK2 was highly expressed 12 h after inoculation with PXO99, clearly indicating that it was probably involved in the early events of rice disease response[1].
  • OsCIPK02 showed ubiquitous expression in all tissues/organs[3], OsCIPK02 containing DRE in their promoter regions was actually induced by drought[2].
  • Real-time RT-PCR analysis confirmed the diurnal expression patterns showing a peak at daytime and a downregulation in the osgi mutant for the three marker genes and nine of the OsCIPK genes, OsCIPK02 is a member of these nine genes (Fig. 1), which indicating that OsCIPK02 might function downstream of OsGI[3].

Evolution

OsCIPK02 belongs to subgroup III, the others are: OsCIPK05, OsCIPK10, OsCIPK11, OsCIPK14, OsCIPK15, OsCIPK18, OsCIPK20, OsCIPK26, and OsCIPK28[3].

Knowledge Extension

Figure 1. Functional gene network analysis of OsCIPK family members.(from reference [3]).
  • From real-time RT-PCR analyses, Giong et al. identified 16 OsCIPK genes showing a significant up- or down-regulation in response to drought stress. Using the probable functional gene network tool, RiceNet, Giong et al. generated a hypothetical functional gene network based on 15 out of 16 OsCIPK proteins (Fig. 2)[3].
  • More than 200 interactions mediated by these OsCIPK proteins. This network was further refined by integrating fold change data showing at least 1 log2-fold up-regulation (red colored nodes in Fig. 2) or less than -1 log2-fold down-regulation (green colored nodes in Fig. 2) under drought stress to all the elements in this network[3].
  • Integrated subcellular localization data further enhances the feasibility of functional

modules consisting of co-expressed functional groups such as CIPK and PPC and other components in the network(Fig. 1)[3].

  • The calcineurin B-like protein–CBL-interacting protein kinase (CBL–CIPK) signaling pathway in plants is a Ca2+-related pathway that responds strongly to both abiotic and biotic environmental stimuli[4]. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells[4].

Labs working on this gene

  • National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China
  • Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
  • Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea
  • State Key Laboratory of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing 210095, China
  • College of Chemistry and Life Sciences, Zhejiang Normal University, Jinhua 321004, China

References

  1. ↑ 1.0 1.1 1.2 1.3 1.4 CHEN X, GU Z, LIU F, et al. Molecular Analysis of Rice CIPKs Involved in Biotic and Abiotic Stress Responses[J]. Chinese Journal of Rice Science, 2010, 6: 003.
  2. ↑ 2.0 2.1 2.2 2.3 Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
  3. ↑ 3.0 3.1 3.2 3.3 3.4 3.5 3.6 3.7 Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
  4. ↑ 4.0 4.1 Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J]. Plant cell reports, 2014, 33(2): 203-214.

Cite error: <ref> tag with name "ref5" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref6" defined in <references> is not used in prior text.

Structured Information

Gene Name

Os07g0678600

Description

Similar to Serine/threonine protein kinase

Version

NM_001067171.1 GI:115474074 GeneID:4344287

Length

2711 bp

Definition

Oryza sativa Japonica Group Os07g0678600, complete gene.

Source

Oryza sativa Japonica Group 

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:29386976..29389686

Sequence Coding Region

29387228..29388559

Expression

GEO Profiles:Os07g0678600

Genome Context

<gbrowseImage1> name=NC_008400:29386976..29389686 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:29386976..29389686 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcggagcagagaggaaatatgttgatgaaaaagtatgagatggggaaattactcgggcaaggaacctttgccaaggtttaccatgcccgtaacaccgagacttctgagagtgttgctatcaagatgattgataaagagaaggttttgaaaggcgggctcatggatcagatcaaacgtgagatttctgtgatgaagttggtgaggcatccaaacattgtgcagttatatgaggtcatggctaccaagactaagatatattttgtgctggagcacgtcaaaggtggagagttgttcaacaaagttcagagaggaagactaaaggaagatgcagcaaggaagtacttccaacaactgatttgcgctgttgacttttgccacagcaggggtgtttatcaccgtgatttgaagccagaaaatcttcttcttgatgagaacagcaatctgaaggtttcagattttggcctaagtgctcttgctgattgcaaaagacaggatgggctgctccacacaacctgtggcacacctgcttatgttgctccagaagtgatcaacagaagaggctatgacggtgctaaggctgacatatggtcttgtggagtgatactctttgtgctattggccggctatctacctttccatgataagaacttgatggatatgtataagaagattgggaaagcagaattcaaatgtccaagttggtttaataccgatgttcgaaggctcttgctcaggatacttgatcctaacccaagtacaaggatctcaatggacaaaatcatggaaaatccttggtttaggaagggtctcgatgcaaagctgctcagatataatctacaaccaaaggatgcaattcctgttgatatgagcacagattttgactccttcaatagcgctccaacattggagaagaagccgtccaacttgaatgcttttgatataatttctttgtcaactggacttgacctctctggtatgtttgaggagtctgataagaaagagtccaaattcacatccaccagtacagcttcaacaatcatatctaagattgaggatattgccaagggcttgcggttgaagctcacaaagaaagatggtggactgttgaagatggaaggctccaagcctggaaggaaaggtgttatgggcattgatgcagagatattcgaggttaccccaaactttcatcttgtggagctaaagaagacaaatggtgatacacttgaataccgtaaggtcttgaaccaagagatgagaccagctttgaaggacatagtctgggcttggcagggtgagcaaccgaagcagcagcagcagccaacgtgctaa</cdnaseq>

Protein Sequence

<aaseq>MAEQRGNMLMKKYEMGKLLGQGTFAKVYHARNTETSESVAIKMI DKEKVLKGGLMDQIKREISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKV QRGRLKEDAARKYFQQLICAVDFCHSRGVYHRDLKPENLLLDENSNLKVSDFGLSALA DCKRQDGLLHTTCGTPAYVAPEVINRRGYDGAKADIWSCGVILFVLLAGYLPFHDKNL MDMYKKIGKAEFKCPSWFNTDVRRLLLRILDPNPSTRISMDKIMENPWFRKGLDAKLL RYNLQPKDAIPVDMSTDFDSFNSAPTLEKKPSNLNAFDIISLSTGLDLSGMFEESDKK ESKFTSTSTASTIISKIEDIAKGLRLKLTKKDGGLLKMEGSKPGRKGVMGIDAEIFEV TPNFHLVELKKTNGDTLEYRKVLNQEMRPALKDIVWAWQGEQPKQQQQPTC</aaseq>

Gene Sequence

<dnaseqindica>1128..2459#attgctgcgccgtgctcgaacagatctcgatctcgatctcgatctccgcacgcaccaaggcgaagccaattccactaccaccgctcttccttcttctcactccttctcgcgactgcggcgagggtgagtctcctgtcgtgagaatttcggtctaccggcggcggcggcggcgttgggtgttcttcgcgtcgtcagacgtcgggatctggtacggttctccttatctctggttgttgataatctatatggatctatggtttgttgattcgtctgtatgtgaaaaacatcatcttgggttagcgaggggtgggtttcagattctcaggtcgagtctccagtacactggttgagtgctcgtttctagatctgtatttgttctgcaacgcgaggtgttgtggttgatgcgattcatgcgaaaacttaatctgtcatacatacttggaagggtaaaaaaagaaaaaaataatctcctttctactggagatgcatagcgtgggaattataattagcctcttgttatctgctagcctggttgttgagcgaagctttcggatccaaccttttaattcagggtagctttatgtagtacagaaaactgtgtaactgtattgtgtttcctgttactttcttttaaaacaagttctggttgaaaagcgtagaaacagtcttaactggcatgtcttgttttcatgcatatgtgctgtgcagtagattaatccttttacctagaacttctcaattgagttttatgttagttgattccaactagtagttgtccatgactgaccttattgcatcttcttcttttggcagaattactagacttccaataagaaggaaacaccttagggaatgcagaaagatgtgcttgcatgctagagagctaccttgtgagggaattggcagggtagcaagccatatttctccttccacaactcttcatgacattggaacacaagagtatatacagcgcttgctccatgtgctctcgcactatggggttcgacgtggcaactcaaccatcttcttagatcaccatcttggtggagacggttgaagtcacctatcatttctaggctcctggttaccacactttgagctttgggattactgctttctttggcgtgatggcggagcagagaggaaatatgttgatgaaaaagtatgagatggggaaattactcgggcaaggaacctttgccaaggtttaccatgcccgtaacaccgagacttctgagagtgttgctatcaagatgattgataaagagaaggttttgaaaggcgggctcatggatcagatcaaacgtgagatttctgtgatgaagttggtgaggcatccaaacattgtgcagttatatgaggtcatggctaccaagactaagatatattttgtgctggagcacgtcaaaggtggagagttgttcaacaaagttcagagaggaagactaaaggaagatgcagcaaggaagtacttccaacaactgatttgcgctgttgacttttgccacagcaggggtgtttatcaccgtgatttgaagccagaaaatcttcttcttgatgagaacagcaatctgaaggtttcagattttggcctaagtgctcttgctgattgcaaaagacaggatgggctgctccacacaacctgtggcacacctgcttatgttgctccagaagtgatcaacagaagaggctatgacggtgctaaggctgacatatggtcttgtggagtgatactctttgtgctattggccggctatctacctttccatgataagaacttgatggatatgtataagaagattgggaaagcagaattcaaatgtccaagttggtttaataccgatgttcgaaggctcttgctcaggatacttgatcctaacccaagtacaaggatctcaatggacaaaatcatggaaaatccttggtttaggaagggtctcgatgcaaagctgctcagatataatctacaaccaaaggatgcaattcctgttgatatgagcacagattttgactccttcaatagcgctccaacattggagaagaagccgtccaacttgaatgcttttgatataatttctttgtcaactggacttgacctctctggtatgtttgaggagtctgataagaaagagtccaaattcacatccaccagtacagcttcaacaatcatatctaagattgaggatattgccaagggcttgcggttgaagctcacaaagaaagatggtggactgttgaagatggaaggctccaagcctggaaggaaaggtgttatgggcattgatgcagagatattcgaggttaccccaaactttcatcttgtggagctaaagaagacaaatggtgatacacttgaataccgtaaggtcttgaaccaagagatgagaccagctttgaaggacatagtctgggcttggcagggtgagcaaccgaagcagcagcagcagccaacgtgctaaaaaactttgacaagggcaagttttttgcaatttgagtcgacttccaatcgtttatgtatttctgcagcttttgttcctcttgttattcattttcattcctcatgtattgttaatattaatatcgatgctatcttcaaatgaggatttatttgaaaaaaatgttgagtttgtttctggatgttactgtttttgctcatggagaactgtaatactgacatttttcatttatcatgacgcaaaaagatgcatatt</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0678600, RefSeq:Os07g0678600

Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os07g0678600&oldid=184780"