Difference between revisions of "Os07g0678600"

From RiceWiki
Jump to: navigation, search
(Expression)
Line 12: Line 12:
 
[[File: OsCIPK2 Expression1.png|right|thumb|250px|'''Figure 1.''' Validation of diurnal expression patterns for OsCIPK2.(from reference <ref name="ref3"/>).'']]  
 
[[File: OsCIPK2 Expression1.png|right|thumb|250px|'''Figure 1.''' Validation of diurnal expression patterns for OsCIPK2.(from reference <ref name="ref3"/>).'']]  
  
*By the RT-PCR-based cDNA cloning approach, '''15''' CIPK genes were cloned from stress-treated seedlings of Nipponbare. Among them, '''10''' genes (''OsCIPK2'', [[Os01g0206700|''OsCIPK5'']], [[Os03g0339900|''OsCIPK10'']], ''OsCIPK11'', ''OsCIPK12'', [[Os12g0113500|''OsCIPK14'']], [[Os11g0113700|''OsCIPK15'']], [[Os05g0332300|''OsCIPK18'']], [[Os06g0543400|''OsCIPK25'']] and [[Os02g0161000|''OsCIPK26'']]) were '''intron-less''', and other '''five''' genes ([[Os01g0292200|''OsCIPK1'']], [[Os03g0319400|''OsCIPK3'']], [[Os03g0634400|''OsCIPK7'']], [[Os07g0150700|''OsCIPK23'']] and [[Os06g0606000|''OsCIPK24'']]) were '''intron-rich''', consistent with the previous data<ref name="ref1"/><ref name="ref2"/>.
+
*By the RT-PCR-based cDNA cloning approach, '''15''' CIPK genes were cloned from stress-treated seedlings of Nipponbare. Among them, '''10''' genes (''OsCIPK2'', [[Os01g0206700|''OsCIPK5'']], [[Os03g0339900|''OsCIPK10'']], ''OsCIPK11'', [[Os01g0759400|''OsCIPK12'']], [[Os12g0113500|''OsCIPK14'']], [[Os11g0113700|''OsCIPK15'']], [[Os05g0332300|''OsCIPK18'']], [[Os06g0543400|''OsCIPK25'']] and [[Os02g0161000|''OsCIPK26'']]) were '''intron-less''', and other '''five''' genes ([[Os01g0292200|''OsCIPK1'']], [[Os03g0319400|''OsCIPK3'']], [[Os03g0634400|''OsCIPK7'']], [[Os07g0150700|''OsCIPK23'']] and [[Os06g0606000|''OsCIPK24'']]) were '''intron-rich''', consistent with the previous data<ref name="ref1"/><ref name="ref2"/>.
 
    
 
    
  

Revision as of 06:20, 29 January 2015

OsCIPK2(OsCIPK02) is a member of CIPK genes (CIPKs,calcineurin B-like protein interacting protein kinases)[1][2].

Annotated Information

Function

  • Interestingly, five OsCIPK genes, OsCIPK1, OsCIPK2, OsCIPK10, OsCIPK11 and OsCIPK12, were transcriptionally up-regulated after bacterial blight infection[1][2].
  • OsCIPK2 was induced by cold and Bacterial blight. It is involved in the biotic stress[1].


GO assignment(s): GO:0004672,GO:0004674, GO:0006468, GO:0005524, GO:0007165

Expression

Figure 1. Validation of diurnal expression patterns for OsCIPK2.(from reference [3]).


  • OsCIPK2 was up-regulated in both roots and shoots, it was also up-regulated in leaves of treated plants. OsCIPK2 was highly expressed 12 h after inoculation with PXO99, clearly indicating that it was probably involved in the early events of rice disease response[1].
  • OsCIPK02 showed ubiquitous expression in all tissues/organs[3], OsCIPK02 containing DRE in their promoter regions was actually induced by drought[2].
  • Real-time RT-PCR analysis confirmed the diurnal expression patterns showing a peak at daytime and a downregulation in the osgi mutant for the three marker genes and nine of the OsCIPK genes, OsCIPK02 is a member of these nine genes (Fig. 1), which indicating that OsCIPK02 might function downstream of OsGI[3].

Evolution

OsCIPK02 belongs to subgroup III, the others are: OsCIPK05, OsCIPK10, OsCIPK11, OsCIPK14, OsCIPK15, OsCIPK18, OsCIPK20, OsCIPK26, and OsCIPK28[3].

Knowledge Extension

Figure 2. Functional gene network analysis of OsCIPK family members.(from reference [3]).
  • From real-time RT-PCR analyses, Giong et al. identified 16 OsCIPK genes showing a significant up- or down-regulation in response to drought stress. Using the probable functional gene network tool, RiceNet, Giong et al. generated a hypothetical functional gene network based on 15 out of 16 OsCIPK proteins (Fig. 2)[3].
  • More than 200 interactions mediated by these OsCIPK proteins. This network was further refined by integrating fold change data showing at least 1 log2-fold up-regulation (red colored nodes in Fig. 2) or less than -1 log2-fold down-regulation (green colored nodes in Fig. 2) under drought stress to all the elements in this network[3].
  • Integrated subcellular localization data further enhances the feasibility of functional modules consisting of co-expressed functional groups such as CIPK and PPC and other components in the network(Fig. 1)[3].
  • The calcineurin B-like protein–CBL-interacting protein kinase (CBL–CIPK) signaling pathway in plants is a Ca2+-related pathway that responds strongly to both abiotic and biotic environmental stimuli[4]. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells[4].

Labs working on this gene

  • National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China
  • Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
  • Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea
  • State Key Laboratory of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing 210095, China
  • College of Chemistry and Life Sciences, Zhejiang Normal University, Jinhua 321004, China

References

  1. 1.0 1.1 1.2 1.3 1.4 CHEN X, GU Z, LIU F, et al. Molecular Analysis of Rice CIPKs Involved in Biotic and Abiotic Stress Responses[J]. Chinese Journal of Rice Science, 2010, 6: 003.
  2. 2.0 2.1 2.2 2.3 Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
  3. 3.0 3.1 3.2 3.3 3.4 3.5 3.6 3.7 Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
  4. 4.0 4.1 Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J]. Plant cell reports, 2014, 33(2): 203-214.

Structured Information

Gene Name

Os07g0678600

Description

Similar to Serine/threonine protein kinase

Version

NM_001067171.1 GI:115474074 GeneID:4344287

Length

2711 bp

Definition

Oryza sativa Japonica Group Os07g0678600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:29386976..29389686

Sequence Coding Region

29387228..29388559

Expression

GEO Profiles:Os07g0678600

Genome Context

<gbrowseImage1> name=NC_008400:29386976..29389686 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:29386976..29389686 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcggagcagagaggaaatatgttgatgaaaaagtatgagatggggaaattactcgggcaaggaacctttgccaaggtttaccatgcccgtaacaccgagacttctgagagtgttgctatcaagatgattgataaagagaaggttttgaaaggcgggctcatggatcagatcaaacgtgagatttctgtgatgaagttggtgaggcatccaaacattgtgcagttatatgaggtcatggctaccaagactaagatatattttgtgctggagcacgtcaaaggtggagagttgttcaacaaagttcagagaggaagactaaaggaagatgcagcaaggaagtacttccaacaactgatttgcgctgttgacttttgccacagcaggggtgtttatcaccgtgatttgaagccagaaaatcttcttcttgatgagaacagcaatctgaaggtttcagattttggcctaagtgctcttgctgattgcaaaagacaggatgggctgctccacacaacctgtggcacacctgcttatgttgctccagaagtgatcaacagaagaggctatgacggtgctaaggctgacatatggtcttgtggagtgatactctttgtgctattggccggctatctacctttccatgataagaacttgatggatatgtataagaagattgggaaagcagaattcaaatgtccaagttggtttaataccgatgttcgaaggctcttgctcaggatacttgatcctaacccaagtacaaggatctcaatggacaaaatcatggaaaatccttggtttaggaagggtctcgatgcaaagctgctcagatataatctacaaccaaaggatgcaattcctgttgatatgagcacagattttgactccttcaatagcgctccaacattggagaagaagccgtccaacttgaatgcttttgatataatttctttgtcaactggacttgacctctctggtatgtttgaggagtctgataagaaagagtccaaattcacatccaccagtacagcttcaacaatcatatctaagattgaggatattgccaagggcttgcggttgaagctcacaaagaaagatggtggactgttgaagatggaaggctccaagcctggaaggaaaggtgttatgggcattgatgcagagatattcgaggttaccccaaactttcatcttgtggagctaaagaagacaaatggtgatacacttgaataccgtaaggtcttgaaccaagagatgagaccagctttgaaggacatagtctgggcttggcagggtgagcaaccgaagcagcagcagcagccaacgtgctaa</cdnaseq>

Protein Sequence

<aaseq>MAEQRGNMLMKKYEMGKLLGQGTFAKVYHARNTETSESVAIKMI DKEKVLKGGLMDQIKREISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKV QRGRLKEDAARKYFQQLICAVDFCHSRGVYHRDLKPENLLLDENSNLKVSDFGLSALA DCKRQDGLLHTTCGTPAYVAPEVINRRGYDGAKADIWSCGVILFVLLAGYLPFHDKNL MDMYKKIGKAEFKCPSWFNTDVRRLLLRILDPNPSTRISMDKIMENPWFRKGLDAKLL RYNLQPKDAIPVDMSTDFDSFNSAPTLEKKPSNLNAFDIISLSTGLDLSGMFEESDKK ESKFTSTSTASTIISKIEDIAKGLRLKLTKKDGGLLKMEGSKPGRKGVMGIDAEIFEV TPNFHLVELKKTNGDTLEYRKVLNQEMRPALKDIVWAWQGEQPKQQQQPTC</aaseq>

Gene Sequence

<dnaseqindica>1128..2459#attgctgcgccgtgctcgaacagatctcgatctcgatctcgatctccgcacgcaccaaggcgaagccaattccactaccaccgctcttccttcttctcactccttctcgcgactgcggcgagggtgagtctcctgtcgtgagaatttcggtctaccggcggcggcggcggcgttgggtgttcttcgcgtcgtcagacgtcgggatctggtacggttctccttatctctggttgttgataatctatatggatctatggtttgttgattcgtctgtatgtgaaaaacatcatcttgggttagcgaggggtgggtttcagattctcaggtcgagtctccagtacactggttgagtgctcgtttctagatctgtatttgttctgcaacgcgaggtgttgtggttgatgcgattcatgcgaaaacttaatctgtcatacatacttggaagggtaaaaaaagaaaaaaataatctcctttctactggagatgcatagcgtgggaattataattagcctcttgttatctgctagcctggttgttgagcgaagctttcggatccaaccttttaattcagggtagctttatgtagtacagaaaactgtgtaactgtattgtgtttcctgttactttcttttaaaacaagttctggttgaaaagcgtagaaacagtcttaactggcatgtcttgttttcatgcatatgtgctgtgcagtagattaatccttttacctagaacttctcaattgagttttatgttagttgattccaactagtagttgtccatgactgaccttattgcatcttcttcttttggcagaattactagacttccaataagaaggaaacaccttagggaatgcagaaagatgtgcttgcatgctagagagctaccttgtgagggaattggcagggtagcaagccatatttctccttccacaactcttcatgacattggaacacaagagtatatacagcgcttgctccatgtgctctcgcactatggggttcgacgtggcaactcaaccatcttcttagatcaccatcttggtggagacggttgaagtcacctatcatttctaggctcctggttaccacactttgagctttgggattactgctttctttggcgtgatggcggagcagagaggaaatatgttgatgaaaaagtatgagatggggaaattactcgggcaaggaacctttgccaaggtttaccatgcccgtaacaccgagacttctgagagtgttgctatcaagatgattgataaagagaaggttttgaaaggcgggctcatggatcagatcaaacgtgagatttctgtgatgaagttggtgaggcatccaaacattgtgcagttatatgaggtcatggctaccaagactaagatatattttgtgctggagcacgtcaaaggtggagagttgttcaacaaagttcagagaggaagactaaaggaagatgcagcaaggaagtacttccaacaactgatttgcgctgttgacttttgccacagcaggggtgtttatcaccgtgatttgaagccagaaaatcttcttcttgatgagaacagcaatctgaaggtttcagattttggcctaagtgctcttgctgattgcaaaagacaggatgggctgctccacacaacctgtggcacacctgcttatgttgctccagaagtgatcaacagaagaggctatgacggtgctaaggctgacatatggtcttgtggagtgatactctttgtgctattggccggctatctacctttccatgataagaacttgatggatatgtataagaagattgggaaagcagaattcaaatgtccaagttggtttaataccgatgttcgaaggctcttgctcaggatacttgatcctaacccaagtacaaggatctcaatggacaaaatcatggaaaatccttggtttaggaagggtctcgatgcaaagctgctcagatataatctacaaccaaaggatgcaattcctgttgatatgagcacagattttgactccttcaatagcgctccaacattggagaagaagccgtccaacttgaatgcttttgatataatttctttgtcaactggacttgacctctctggtatgtttgaggagtctgataagaaagagtccaaattcacatccaccagtacagcttcaacaatcatatctaagattgaggatattgccaagggcttgcggttgaagctcacaaagaaagatggtggactgttgaagatggaaggctccaagcctggaaggaaaggtgttatgggcattgatgcagagatattcgaggttaccccaaactttcatcttgtggagctaaagaagacaaatggtgatacacttgaataccgtaaggtcttgaaccaagagatgagaccagctttgaaggacatagtctgggcttggcagggtgagcaaccgaagcagcagcagcagccaacgtgctaaaaaactttgacaagggcaagttttttgcaatttgagtcgacttccaatcgtttatgtatttctgcagcttttgttcctcttgttattcattttcattcctcatgtattgttaatattaatatcgatgctatcttcaaatgaggatttatttgaaaaaaatgttgagtttgtttctggatgttactgtttttgctcatggagaactgtaatactgacatttttcatttatcatgacgcaaaaagatgcatatt</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0678600, RefSeq:Os07g0678600