|
|
| (7 intermediate revisions by one other user not shown) |
| Line 3: |
Line 3: |
| | ==Annotated Information== | | ==Annotated Information== |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| + | MYBGA (also called GAMYB) is a GA-inducible R2R3 MYB that binds to the GARE and activates promoters ofa-amylases and other hydrolases in rice.MYBGA is regarded as a major transcription factor in the GA signaling pathway.The rice protein MYBS1 is a sugar-repressible R1MYB that binds to the TA box and activatesa-amylase promoters in rice suspension cells and embryos under sugar starvation. MYBS1 is a positive activator of a-amylase promoters in response to GA and sugar starvation, which further indicates that MYBS1 may serve as amoduleofcrosstalkbetweentheGAand sugarstarvationsig-naling pathways. |
| − | It can integrate different hunger and GA signal transduction pathway of nutrients.When the presence of sugar can inhibit the synthesis and transport in the nucleus of the MYBS1,whereas when sugar starvation induces the synthesis of MYBS1 proteins and its transport in the nucleus.
| |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | Please input expression information here.
| + | It is induced by nutrient starvation and GA. |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| − | Please input evolution information here.
| + | The rice and barley MYBGAgenes share 88% homology throughout their coding regions and 99% homology in the R2 and R3 repeats. |
| − | | |
| − | You can also add sub-section(s) at will.
| |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | 1. Institute of Molecular Biology and Institute of Plant and Microbial Biology in Academia Sinica |
| | + | 2. Department of Agronomy in National Chia-Yi University |
| | + | 3. Department of Photonics and Communication Engineering in Asia University |
| | + | 4. Department of Life Sciences, National Central University |
| | + | 5. Institute of Agricultural Biotechnology in National Chia-Yi University |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | 1. Ya-Fang Hong;Tuan-Hua David Ho;Chin-Feng Wu;Shin-Lon Ho;Rong-Hwei Yeh;Chung-An Lu;Peng-Wen Chen;Lin-Chih Yu;Annlin Chao;Su-May Yu Convergent Starvation Signals and Hormone Crosstalk in Regulating Nutrient Mobilization upon Germination in Cereals The Plant Cell, 2012, 24(7): 2857-2873. |
| − | 1. Ya-Fang Hong;Tuan-Hua David Ho;Chin-Feng Wu;Shin-Lon Ho;Rong-Hwei Yeh;Chung-An Lu;Peng-Wen Chen;Lin-Chih Yu;Annlin Chao;Su-May Yu | + | 2. Tsuji, H., Aya, K., Ueguchi-Tanaka, M., Shimada, Y., Nakazono, M.,Watanabe,R.,Nishizawa,N.K.,Gomi,K.,Shimada,A.,Kitano,H., Ashikari, M., and Matsuoka, M. (2006). GAMYB controls dif-ferent sets of genes and is differentially regulated by microRNA in aleurone cells and anthers. Plant J.47:427–444. |
| − | Convergent Starvation Signals and Hormone Crosstalk in Regulating Nutrient Mobilization upon Germination in Cereals
| + | 3. Lu, C.A., Lin, C.C., Lee, K.W., Chen, J.L., Huang, L.F., Ho, S.L., Liu,H.J.,Hsing,Y.I.,andYu, S.M.(2007). The SnRK1A protein kinase plays a key role in sugar signaling during germination and seed linggrowth of rice. Plant Cell19:2484–2499. |
| − | The Plant Cell, 2012, 24(7): 2857-2873
| + | 4. Gubler, F., Watts, R.J., Kalla, R., Matthews, P., Keys, M., and Jacobsen, J.V.(1997). Cloning of a rice cDNA encoding a transcription factor homologous to barley GAMyb. Plant Cell Physiol. 38:362–365. |
| | + | 5. Lu, C.A., Ho, T.H., Ho, S.L., and Yu, S.M.(2002). Three novel MYB proteins with one DNA binding repeat mediate sugar and hormone regulation ofa-amylase gene expression. Plant Cell14:1963–1980. |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]] |
| − | GeneName = Os01g0812000|
| |
| − | Description = Similar to GAMyb protein|
| |
| − | Version = NM_001051127.1 GI:115440624 GeneID:4327362|
| |
| − | Length = 4287 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os01g0812000, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
| |
| − | AP = Chromosome 1:36264299..36268585|
| |
| − | CDS = 36265256..36265624,36266882..36267905,36267976..36268244|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008394:36264299..36268585
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008394:36264299..36268585
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgtatcgggtgaagagcgagagcgactgcgatatgatccatcaggagcagatggactcgccggtggccgacgacggcagcagcggggggtcgccgcaccgcggcggcgggcccccgctgaagaaggggccatggacgtcggcggaggacgccatcctggtggactacgtgaagaagcacggcgaggggaactggaacgcggtgcagaagaacaccgggctgttccggtgcggcaagagctgccgcctccggtgggcgaaccacctgaggcccaacctcaagaagggggccttcaccgccgaggaggagaggctcatcatccagctccactccaagatggggaacaagtgggctcggatggccgctcatttgccagggcgcactgataatgaaataaagaattactggaatactcgaataaagagatgccagcgagctggcctacccatctatcctaccagcgtatgcaatcaatcctcaaatgaagatcagcagtgctccagtgattttgactgtggcgagaatttgtcaaacgatcttctgaatgcaaatggtctttacctaccagattttacctgtgacaatttcattgctaattcagaggctttaccttatgcaccacatctttcagccgtttctataagcaatctccttggccagagctttgcatcaaaaagctgtagcttcatggatcaggtaaaccagacagggatgctaaaacagtctgatggtgtgcttcctggattgagcgataccatcaacggtgtgatttcctcggtggatcaattctcaaatgactctgagaagctcaagcaggctgtgggttttgactatctccatgaagccaactctaccagcaagattattgcacctttcgggggtgcacttaatggcagccatgcctttttaaatggcaatttctctgcttctaggcccacaagtggtcctttgaagatggagctcccttcactccaagatactgaatctgatccaaacagctggctcaagtacactgtagctcctgcgttgcagcctactgagttagttgatccctacctgcagtctccagcagcaaccccttcagtgaaatcagagtgcgcgtcgccaaggaatagtggccttttggaagagttgattcatgaagctcagaccctaagatccgggaagaaccaacagacatctgtgataagttctagttcttctgtcggtacgccatgtaatactacggttcttagcccagagtttgatatgtgtcaggaatactgggaagaacaacatcctggtccattcctcaatgactgtgctcctttcagtggcaattcattcactgaatccacccctcctgttagcgctgcatcgcctgacatctttcagctctccaaagtttccccagcacaaagcacttcaatgggatctggagagcaagtaatggggcctaaatatgaacctggggacacttcacctcatcctgaaaacttcaggccagatgcattgttttctgggaatacagctgatccatcagttttcaacaatgccatagcaatgcttctgggcaatgacttgagtatcgattgcagacctgttcttggcgacggtatcatgttcaattcttcctcgtggagcaacatgccacacgcctgtgaaatgtcagaattcaaatga</cdnaseq>|
| |
| − | AA = <aaseq>MYRVKSESDCDMIHQEQMDSPVADDGSSGGSPHRGGGPPLKKGP WTSAEDAILVDYVKKHGEGNWNAVQKNTGLFRCGKSCRLRWANHLRPNLKKGAFTAEE ERLIIQLHSKMGNKWARMAAHLPGRTDNEIKNYWNTRIKRCQRAGLPIYPTSVCNQSS NEDQQCSSDFDCGENLSNDLLNANGLYLPDFTCDNFIANSEALPYAPHLSAVSISNLL GQSFASKSCSFMDQVNQTGMLKQSDGVLPGLSDTINGVISSVDQFSNDSEKLKQAVGF DYLHEANSTSKIIAPFGGALNGSHAFLNGNFSASRPTSGPLKMELPSLQDTESDPNSW LKYTVAPALQPTELVDPYLQSPAATPSVKSECASPRNSGLLEELIHEAQTLRSGKNQQ TSVISSSSSVGTPCNTTVLSPEFDMCQEYWEEQHPGPFLNDCAPFSGNSFTESTPPVS AASPDIFQLSKVSPAQSTSMGSGEQVMGPKYEPGDTSPHPENFRPDALFSGNTADPSV FNNAIAMLLGNDLSIDCRPVLGDGIMFNSSSWSNMPHACEMSEFK</aaseq>|
| |
| − | DNA = <dnaseqindica>958..1326#2584..3607#3678..3946#cccatcctgcagactcgccccactctcttgctcagctcctcttcatccagtcctcaaaactctctctgatctctctctcttgctgaaaattctccgcacactccggtgggcttaagcggtggcggcgtctcgcctgggtgggcgagatccctctcttgctcgtccgcaaggtcgctccccctgcgagtccaatctactgacgagctgggaggagcaaaggagggggcaattggagctccgctcggttccaattcagccccaattttgagccccccggctgcggggttcggccaggttagctcctgttcttgcggaattctggctctttttttttttggggtggagaggggatgatctgggtggggtggggagtggtggaattctggtttttttttttttgttctttctttggctggttttgttccgtggggattgaattctcggttctcgtcacctcaggagtggtgttcgcgctgcttgttttggttgatctgtgaattatgggggaagacaccaccttttctctcgtttcttgcacttaaaaatcgtctttggtgagctgttgtgcttggggagctcttgagctgagcaggttcggtttaatctttgattgggttctatacttcactgtttcggtgttcccctctgccgaatttgggaatcaagaggttctgatccatcagtatcactcggcttctcgtcattgcatatgtacaaaacctgcttttttcaatcactcatgtagtcatgtctaattggtttgtcttttatcatcttttggtgtaacttgtctgtgtcactaaccatgccataatttttttttcatgggtactatgtgatcgatttcttcttcttcttcttcttcttcttttttaaatttttacctgtcataattcaagtagtagcagtagtaatctaatctaaagcttccaaattttccggtgtagttgagacgccatgtatcgggtgaagagcgagagcgactgcgatatgatccatcaggagcagatggactcgccggtggccgacgacggcagcagcggggggtcgccgcaccgcggcggcgggcccccgctgaagaaggggccatggacgtcggcggaggacgccatcctggtggactacgtgaagaagcacggcgaggggaactggaacgcggtgcagaagaacaccgggctgttccggtgcggcaagagctgccgcctccggtgggcgaaccacctgaggcccaacctcaagaagggggccttcaccgccgaggaggagaggctcatcatccagctccactccaagatggggaacaagtgggctcggatggccgctcatgtaagtcccgtcccccccccccggtgtttgatcccatttgctgtacgtatttgttcatactaagcagttgagagattgctgttcttactcctaaagatttcccctgagtcatggtcagttaaaagcttattataggtttacttgatcttttgcctaatctgatgatatgcgcagttcttcatccaccacctaacttgatgtttccagggagaattggtgtgctattagatcattttaattttagttccaagttgtagaattcgtttgtagtgattggttgattgcctttcttgaaggatacttttatgggtttttatcaagtgaagtattttgtttcacggattagaattgtattaaacattattttccttggtgttacttgtatgctctaaaacattaacttatatttttctagtgcaaggcagaaagttatcaagcttttggtttagaaattaggtttggtgatttttaaaaggactctcatgtagtacagtagcaacctgcatgaagccctactgctttcaatttccaaaattgatttacaattcttaaggttctaagcttagatctaagcataccgttcacttttacatgattcttctgtagctttatcttctcaagttcatctttgtcggttttactcctgcatggatgcggtcatgatcatatgggaagatgggcttaggtattcttcatgtgagtagcaaagaatacaaatagtgttcatcaccagctttgttgttactgagagcaagttgtgctacgtcgaaggttgaaaattgtttggtgcagttgtttgccttaaatctgttcattttggattgttcactgtgttagaaggggttgggaacaagcctagctaaattgtccgttgtctaggactctaaacagcatagttacaattcacaaggtaacataattgatatctatttcagtctgaccaagtagtgctattattcttcgcaagcttagagtaaccatctaaggcctttcaatcttgttaactttcatgattcacagaatcgaattaattttttgtcataatagtgtgaacttactgagtttctatgatttcttgaactgatcaaacttgtccacgtaatgatgtgagtgaaaattaggctgttgtctgccgaattatttcatatgtatcctgtgtatctaagtctttagagtaagcttatcatttatcctgaactctttgcacatattttctgtattttttcctctttacttacattgagcacatcttctcagttgccagggcgcactgataatgaaataaagaattactggaatactcgaataaagagatgccagcgagctggcctacccatctatcctaccagcgtatgcaatcaatcctcaaatgaagatcagcagtgctccagtgattttgactgtggcgagaatttgtcaaacgatcttctgaatgcaaatggtctttacctaccagattttacctgtgacaatttcattgctaattcagaggctttaccttatgcaccacatctttcagccgtttctataagcaatctccttggccagagctttgcatcaaaaagctgtagcttcatggatcaggtaaaccagacagggatgctaaaacagtctgatggtgtgcttcctggattgagcgataccatcaacggtgtgatttcctcggtggatcaattctcaaatgactctgagaagctcaagcaggctgtgggttttgactatctccatgaagccaactctaccagcaagattattgcacctttcgggggtgcacttaatggcagccatgcctttttaaatggcaatttctctgcttctaggcccacaagtggtcctttgaagatggagctcccttcactccaagatactgaatctgatccaaacagctggctcaagtacactgtagctcctgcgttgcagcctactgagttagttgatccctacctgcagtctccagcagcaaccccttcagtgaaatcagagtgcgcgtcgccaaggaatagtggccttttggaagagttgattcatgaagctcagaccctaagatccgggaagaaccaacagacatctgtgataagttctagttcttctgtcggtacgccatgtaatactacggttcttagcccagagtttgatatgtgtcaggaatactgggaagaacaacatcctggtccattcctcaatgactgtgctcctttcagtggcaattcattcactgaatccacccctcctgttagcgctgcatcgcctgacatctttcagctctccaaagtttccccaggttggactctgaaattcctcatccctctttgatgtgattattcggttatttatgatgtactgttttgcagcacaaagcacttcaatgggatctggagagcaagtaatggggcctaaatatgaacctggggacacttcacctcatcctgaaaacttcaggccagatgcattgttttctgggaatacagctgatccatcagttttcaacaatgccatagcaatgcttctgggcaatgacttgagtatcgattgcagacctgttcttggcgacggtatcatgttcaattcttcctcgtggagcaacatgccacacgcctgtgaaatgtcagaattcaaatgaattctgtatttggtatttgccagacgctacagcagattcttggtatcgttcttgctcattgtttggatcataacttgaggaagatctcgtcggttgtaattctgcattgctgacagagtccttgatggcatgcaggcactatcagatgttctcttatgcgactagcccttttgtccaataaagtagtgcatggagataagccggttaattattgttttcttttttgtattagagaaccctttttgtcatctctattgcccgaattctgttggaaattcgtcatgtttgtttgaacaatgtaagaccaattattgcatttgtggtgtactatcttgttgagc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051127.1 RefSeq:Os01g0812000]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 1]]
| |
| − | [[Category:Chromosome 1]]
| |
Please input one-sentence summary here.
Annotated Information
Function
MYBGA (also called GAMYB) is a GA-inducible R2R3 MYB that binds to the GARE and activates promoters ofa-amylases and other hydrolases in rice.MYBGA is regarded as a major transcription factor in the GA signaling pathway.The rice protein MYBS1 is a sugar-repressible R1MYB that binds to the TA box and activatesa-amylase promoters in rice suspension cells and embryos under sugar starvation. MYBS1 is a positive activator of a-amylase promoters in response to GA and sugar starvation, which further indicates that MYBS1 may serve as amoduleofcrosstalkbetweentheGAand sugarstarvationsig-naling pathways.
Expression
It is induced by nutrient starvation and GA.
Evolution
The rice and barley MYBGAgenes share 88% homology throughout their coding regions and 99% homology in the R2 and R3 repeats.
Labs working on this gene
1. Institute of Molecular Biology and Institute of Plant and Microbial Biology in Academia Sinica
2. Department of Agronomy in National Chia-Yi University
3. Department of Photonics and Communication Engineering in Asia University
4. Department of Life Sciences, National Central University
5. Institute of Agricultural Biotechnology in National Chia-Yi University
References
1. Ya-Fang Hong;Tuan-Hua David Ho;Chin-Feng Wu;Shin-Lon Ho;Rong-Hwei Yeh;Chung-An Lu;Peng-Wen Chen;Lin-Chih Yu;Annlin Chao;Su-May Yu Convergent Starvation Signals and Hormone Crosstalk in Regulating Nutrient Mobilization upon Germination in Cereals The Plant Cell, 2012, 24(7): 2857-2873.
2. Tsuji, H., Aya, K., Ueguchi-Tanaka, M., Shimada, Y., Nakazono, M.,Watanabe,R.,Nishizawa,N.K.,Gomi,K.,Shimada,A.,Kitano,H., Ashikari, M., and Matsuoka, M. (2006). GAMYB controls dif-ferent sets of genes and is differentially regulated by microRNA in aleurone cells and anthers. Plant J.47:427–444.
3. Lu, C.A., Lin, C.C., Lee, K.W., Chen, J.L., Huang, L.F., Ho, S.L., Liu,H.J.,Hsing,Y.I.,andYu, S.M.(2007). The SnRK1A protein kinase plays a key role in sugar signaling during germination and seed linggrowth of rice. Plant Cell19:2484–2499.
4. Gubler, F., Watts, R.J., Kalla, R., Matthews, P., Keys, M., and Jacobsen, J.V.(1997). Cloning of a rice cDNA encoding a transcription factor homologous to barley GAMyb. Plant Cell Physiol. 38:362–365.
5. Lu, C.A., Ho, T.H., Ho, S.L., and Yu, S.M.(2002). Three novel MYB proteins with one DNA binding repeat mediate sugar and hormone regulation ofa-amylase gene expression. Plant Cell14:1963–1980.
Structured Information