|
|
| (5 intermediate revisions by 2 users not shown) |
| Line 3: |
Line 3: |
| | ==Annotated Information== | | ==Annotated Information== |
| | ===Function=== | | ===Function=== |
| − | DTH2 behaves as a single Mendelian factor,it encodes a CONSTANS-like protein that promotes heading by inducing theflorigen genes Heading date 3a and RICE FLOWERING LOCUS T 1, and it acts independently of the known floral integrators Heading date 1 and Early heading date 1.DTH2 likely represents a target of human selection for adaptation to LD conditions during rice domestication and/or improvement, demonstrating an important role of minor-effect quantitative trait loci in crop adaptation and breeding.[1] | + | DTH2 behaves as a single Mendelian factor,it encodes a CONSTANS-like protein that promotes heading by inducing theflorigen genes Heading date 3a and RICE FLOWERING LOCUS T 1, and it acts independently of the known floral integrators Heading date 1 and Early heading date 1.DTH2 likely represents a target of human selection for adaptation to LD conditions during rice domestication and/or improvement, demonstrating an important role of minor-effect quantitative trait loci in crop adaptation and breeding.<ref name="ref1" /> |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | DTH2 transcripts were detected in all tissues examined,but its expression was most abundant in leaf blade and sheath,it is also found that DTH2 expression is controlled by the circadian clock [1] | + | DTH2 transcripts were detected in all tissues examined,but its expression was most abundant in leaf blade and sheath,it is also found that DTH2 expression is controlled by the circadian clock <ref name="ref1" /> |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| − | A4 allele of DHT2 may have undergone intensive selection during the northward expansion ofjaponicarice to NLD conditions in Asia.Another assay finds that the | + | Research indicates that A4 allele of DHT2 may have undergone intensive selection during the northward expansion ofjaponicarice to NLD conditions in Asia.Another assay finds that the diversity at the genes surrounding DTH2 in japonica is reduced.It can be explained by the combination of domestication bottleneck and selective sweep around DTH2, providing additional evidence that DTH2 has been subjected to artificial selection during domestication or improvement ofjaponica rice.<ref name="ref1" /> |
| − | diversity at the genes surrounding DTH2in japonica is reduced.It can be explained by the combination of domestication bottleneck and selective sweep aroundDTH2, providing additional evidence thatDTH2 has been subjected to artificial selection during domestication or improvement ofjaponica rice.[1]
| |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| | [1]National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University,Nanjing 210095, China | | [1]National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University,Nanjing 210095, China |
| | + | |
| | [2]National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Sciences, Chinese Academy of Agricultural Sciences, Beijing 100081, China | | [2]National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Sciences, Chinese Academy of Agricultural Sciences, Beijing 100081, China |
| | + | |
| | [3]State Key Laboratory of Systematic and Evolutionary Botany, Institute of Botany, Chinese Academy of Sciences,Beijing 100093, China | | [3]State Key Laboratory of Systematic and Evolutionary Botany, Institute of Botany, Chinese Academy of Sciences,Beijing 100093, China |
| | | | |
| | ==References== | | ==References== |
| − | [1]Wu W, Zheng XM, Lu G, Zhong Z, Gao H, Chen L, Wu C, Wang HJ, Wang Q, Zhou K,Wang JL, Wu F, Zhang X, Guo X, Cheng Z, Lei C, Lin Q, Jiang L, Wang H, Ge S, Wan
| + | <references> |
| | + | <ref name="ref1"> |
| | + | Wu W, Zheng XM, Lu G, Zhong Z, Gao H, Chen L, Wu C, Wang HJ, Wang Q, Zhou K,Wang JL, Wu F, Zhang X, Guo X, Cheng Z, Lei C, Lin Q, Jiang L, Wang H, Ge S, Wan |
| | J. Association of functional nucleotide polymorphisms at DTH2 with the northward expansion of rice cultivation in Asia. Proc Natl Acad Sci U S A. 2013 Feb | | J. Association of functional nucleotide polymorphisms at DTH2 with the northward expansion of rice cultivation in Asia. Proc Natl Acad Sci U S A. 2013 Feb |
| | 19;110(8):2775-80. doi: 10.1073/pnas.1213962110. Epub 2013 Feb 6. PubMed PMID:23388640; PubMed Central PMCID: PMC3581972. | | 19;110(8):2775-80. doi: 10.1073/pnas.1213962110. Epub 2013 Feb 6. PubMed PMID:23388640; PubMed Central PMCID: PMC3581972. |
| | + | </ref> |
| | + | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]] |
| − | GeneName = Os02g0724000|
| |
| − | Description = Zinc finger, B-box domain containing protein|
| |
| − | Version = NM_001054510.1 GI:115448390 GeneID:4330574|
| |
| − | Length = 4797 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os02g0724000, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
| |
| − | AP = Chromosome 2:30981208..30986004|
| |
| − | CDS = 30983167..30983754,30984251..30984451,30984722..30985026,30985312..30985441|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008395:30981208..30986004
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008395:30981208..30986004
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggatgctctttgtgatttctgcagggagcaaaggtcaatggtctattgccgatcagatgcagcatccttgtgcttgtcgtgtgatcgtaatgtgcattcagccaatgccctttcccgacgccatacaagaacccttctttgtgatcgttgtgttggacagcctgcagcagtccgttgtcttgaagagaacacctcactttgccaaaactgtgactggaatggacatggggcagcatcctcagctgctgggcataaaaggcagaccataaactgttactcggggtgcccatcgtcggcagagctctcgagaatctggtcctttagtatggatatcccaactgtagctgcggagccaaactgtgaggaaggaataaacatgatgagcattaatgacaatgacgtcaataaccattgtggtgctccagaagatggccgcttgttggatatagctagcacagcactcatgagtgatttacctacaggagacaagttcaaacctttaataggttcttcttcaggagatgggatgaatcttctgccacttaattcagatcagccagctgagccagtttcaacgacgcctaaggcaccctgtgtcacagacaaagatatgttcaatgatgggagcgtatatggagacttctgtgtggatgatgctgacctaacatttgagaattatgaagaattattcggtacctctcacgttcaaacagaacaactctttgatgatgctggaattgacagttattttgaaatgaaggatgtgccagcagatgaatctaatgagcagcccaaacctgtgcagccagaatgtagcaatgtcgcatctgttgattctgggatgtcaaacccagctgcaagggctgattccagccattgtattcctggtaggcaggctatatccaacatatccctttccttctctggtttgactggtgaaagcagtgctggatattttcaagattgtggggtatcgtcaatgatccttatgggtgagccaccctggcatcctcctggtcctgaaagttcatctgctggaggcagcagagataatgctcttacacggtacaaggagaagaagaagagaagaaaatttgacaagaagataaggtatgcttctcgtaaggctagggcagatgtgagaaaaagggtcaaaggacggtttgtaaaggctggcgaagcatatgactacgatccgctgagccaaacaagaagctactaa</cdnaseq>|
| |
| − | AA = <aaseq>MDALCDFCREQRSMVYCRSDAASLCLSCDRNVHSANALSRRHTR TLLCDRCVGQPAAVRCLEENTSLCQNCDWNGHGAASSAAGHKRQTINCYSGCPSSAEL SRIWSFSMDIPTVAAEPNCEEGINMMSINDNDVNNHCGAPEDGRLLDIASTALMSDLP TGDKFKPLIGSSSGDGMNLLPLNSDQPAEPVSTTPKAPCVTDKDMFNDGSVYGDFCVD DADLTFENYEELFGTSHVQTEQLFDDAGIDSYFEMKDVPADESNEQPKPVQPECSNVA SVDSGMSNPAARADSSHCIPGRQAISNISLSFSGLTGESSAGYFQDCGVSSMILMGEP PWHPPGPESSSAGGSRDNALTRYKEKKKRRKFDKKIRYASRKARADVRKRVKGRFVKA GEAYDYDPLSQTRSY</aaseq>|
| |
| − | DNA = <dnaseqindica>1960..2547#3044..3244#3515..3819#4105..4234#cgctcgctctccctttcgcgcaccagaaaagtcgttttttaattttcgagtttccgtggaagattctcgatacctgtccctcgtcgtcgtcctcctccgccggccgccgccgacgaccgcagcaggggtggatccggggcggcgccgattcggtgagtccggtctcgcgagctcgagctgtttgtttgtttgtttgtttggtggggattggattgggttggatttgcgttgtgtaggctagccgcatcagcgccgcttgtttggtggatttcgtgagctgctgctggattagggggctgggattgggattgggaggggggatggatcatggatgtcggtggattgggggggattgggtttgagtgttcgatttcgagtccgcttgatcgtttctgtggtgttccagggtgtttggtgttggggagtctgaactgattttttggttttctttctttttgcggacacttcacgctttctctcgtgttgcgtggagcgtacgtgagtggtttttggtccggctttagctttgagctggactttagctgctcagaatttgattatttttctttctctaattggagtacatacaagtacgatggcttagcatgtttcagtatccagttcagttttcaactagaaaatattaacaatttcatcccctctgcccttttgtctactgacataatagtcgtgtagcggcaactgcggttagatgcagaaaggaagcccttttgtattcttaaatttggataatcttaaaaaacaaaataacatttctcttgcttatttgagtggctcagaaagtttgttgcttttatccacacacggcatgctttatatgatcagagaagtggggttagtgctatttaaaacttaggattagtcccgataaaattgtttgtattgtggagatgcatgcttgttgatttacatgattagtgctcagaaaaggtgcccttttgatatgcaaaataggacataccagcgtcaaaaataaagggacataataaaatgagcaaccaggatcattgttggatgcacagctggtgaagtcctatttgtattgccgcttctagctcttgcccatgcatgctaataagccatcccatgctggtacgaaaagtgacttttattaactcagaaatgctatcaactgcagctagcatttgtttgctgcatagctccatgttgctaatttcatgtttttccattgttatcagatgcattgtactgctctctgctagacttgtctagtgaattggtgttattgacccttattttttaaacatggatacttttttcccccttatatgctttacagagaacatgcgcttacaggttacagactgacagtacataggatagaagataaaaccgtaacatttaccaagaaaaacttcctgcaagtagttttgtgcccttctatttcagagacttttgagttctttatgcccttgctagcaaatcttgggtgggataataaaactcaaaactcttcacaaattgttatacgctacctatattttaaattgttactaagtcaatgaatatattgattgctcttgttgtgatacatttgaaatgtttctgttggttgcagagcaattcaagtggttcatttcatggcctgtatcaatatacttatatatctccaacacttaccaaggaatggaaacaaactcatcatgtaacatgggctgcaaaatctgtcccttcttttctaatttgaagtgtgcacatatttgctatattttccattaaaaaaatatactactctctttccataatgttcaattataagtttgttgttttgttgttactgatttttgtttttggctttttgcacaccagtatcctggtaggatcccactgaattcaactgttgaacaaaaagccaggaaggtggctgttcttgtggcactcagtgctagtggaagtgctccagtactgtacaggaccatggatgctctttgtgatttctgcagggagcaaaggtcaatggtctattgccgatcagatgcagcatccttgtgcttgtcgtgtgatcgtaatgtgcattcagccaatgccctttcccgacgccatacaagaacccttctttgtgatcgttgtgttggacagcctgcagcagtccgttgtcttgaagagaacacctcactttgccaaaactgtgactggaatggacatggggcagcatcctcagctgctgggcataaaaggcagaccataaactgttactcggggtgcccatcgtcggcagagctctcgagaatctggtcctttagtatggatatcccaactgtagctgcggagccaaactgtgaggaaggaataaacatgatgagcattaatgacaatgacgtcaataaccattgtggtgctccagaagatggccgcttgttggatatagctagcacagcactcatgagtgatttacctacaggagacaagttcaaacctttaataggttcttcttcaggagatgggatgaatcttctgccacttaattcagatcagccagctgagccagtttcaacgacgcctaaggtgcatgcttctcattcccctccaaaacctattcaagtattctgctaagtttctgcataggtcataacatattgcatggacatattattacaccaaatgttcacactgcgtggttgcggtttcgaccatgtactttgttttggtattcttctagaagtgaacgttcgaagggaaaactttctgtagtttgaccaatggtacaatgaccatcttttggtcattatttattactgtttgctactttcttaagagttccacactgtcaaagctttcctggtgtttttctcctgccgagcaagttactcttatcttctaataattttaccattgaatgtgaattcacctagatcttataattccctaatgatgatggttgaacaattgctgcagttggaatttgtgtatttccaatatcattattcatgaaaatgtcatctgcgatgcctgtcattatggtgtcactgcgtgcttatcgaaacttggttgcataattcaggcaccctgtgtcacagacaaagatatgttcaatgatgggagcgtatatggagacttctgtgtggatgatgctgacctaacatttgagaattatgaagaattattcggtacctctcacgttcaaacagaacaactctttgatgatgctggaattgacagttattttgaaatgaaggatgtgccagcagatgaatctaatgaggtccgtacctttctgcatatagtctttttatctgctgtgtttgttgtaggaaaagagctctgttttgctatttctgaccttcccgccataatcagggttaatctcgttttcctccatttgtgcttatatcgagttgaccctaccattttactgagaatcattaaatgattgattgggttaattaggagtggaatgtctgcatatctcatcgtccattttatggctattaattattttactaaaattttggtatgactgttatactttcagcagcccaaacctgtgcagccagaatgtagcaatgtcgcatctgttgattctgggatgtcaaacccagctgcaagggctgattccagccattgtattcctggtaggcaggctatatccaacatatccctttccttctctggtttgactggtgaaagcagtgctggatattttcaagattgtggggtatcgtcaatgatccttatgggtgagccaccctggcatcctcctggtcctgaaagttcatctgctggaggcagcagagataatgctcttacacggtacaaggagaagaagaagagaagaaagtaagtgcatcttactgtgctttttcagttttttgaaagtaagttcatactagtacttgatatgccatggttaaatgcattacagctaagaatgtggctgcagtatcattcaattttcagatttggaattctatattaaaaagcttactgtgccaaatcgatattttcgtatacacgtgatcattttagacatgtggatgcttgctcctagtgtgaatgctactttatgtttttcttaaaagaagttattatatggcctttcttcacatattttcttcttaacagatttgacaagaagataaggtatgcttctcgtaaggctagggcagatgtgagaaaaagggtcaaaggacggtttgtaaaggctggcgaagcatatgactacgatccgctgagccaaacaagaagctactaaagcctttcactcgattggtttcgtccagtgttcaagtagcaattttcagcagctgatttgatgttggttgcacggcaagcatgatcactggagaacacaagcaattgcggcagaccttgcaattgaaaacggggaaaggaaaccaaacgctgtgatcaaatcaaattaatgaaataaaaaaggaaaaaataggatgcaaacatgcgagaagctcatggatggtaatgctccattttctcctgtacagttcatgcatcttcagttgcttctggttgagatgtctgaatcactctctaccatctgtgcattaatcaaatacaaatacatgggcctaccgcacgacgacgaacgcacctgcttctgttgtgatgttttgtgttgcggctgtcaggctggatctctaggtaacatgattaattatactactgatggaatttgcaccgctgtaatattatttacgaatcacaatctgccgtgggattgttcttctgtcgtgtatgtatgtgtatatagatggatggctgttaagaaaatattgtgacgattataaagtttacctttgt</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054510.1 RefSeq:Os02g0724000]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 2]]
| |
| − | [[Category:Chromosome 2]]
| |
Please input one-sentence summary here.
Annotated Information
Function
DTH2 behaves as a single Mendelian factor,it encodes a CONSTANS-like protein that promotes heading by inducing theflorigen genes Heading date 3a and RICE FLOWERING LOCUS T 1, and it acts independently of the known floral integrators Heading date 1 and Early heading date 1.DTH2 likely represents a target of human selection for adaptation to LD conditions during rice domestication and/or improvement, demonstrating an important role of minor-effect quantitative trait loci in crop adaptation and breeding.[1]
Expression
DTH2 transcripts were detected in all tissues examined,but its expression was most abundant in leaf blade and sheath,it is also found that DTH2 expression is controlled by the circadian clock [1]
Evolution
Research indicates that A4 allele of DHT2 may have undergone intensive selection during the northward expansion ofjaponicarice to NLD conditions in Asia.Another assay finds that the diversity at the genes surrounding DTH2 in japonica is reduced.It can be explained by the combination of domestication bottleneck and selective sweep around DTH2, providing additional evidence that DTH2 has been subjected to artificial selection during domestication or improvement ofjaponica rice.[1]
Labs working on this gene
[1]National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University,Nanjing 210095, China
[2]National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Sciences, Chinese Academy of Agricultural Sciences, Beijing 100081, China
[3]State Key Laboratory of Systematic and Evolutionary Botany, Institute of Botany, Chinese Academy of Sciences,Beijing 100093, China
References
- ↑ 1.0 1.1 1.2
Wu W, Zheng XM, Lu G, Zhong Z, Gao H, Chen L, Wu C, Wang HJ, Wang Q, Zhou K,Wang JL, Wu F, Zhang X, Guo X, Cheng Z, Lei C, Lin Q, Jiang L, Wang H, Ge S, Wan
J. Association of functional nucleotide polymorphisms at DTH2 with the northward expansion of rice cultivation in Asia. Proc Natl Acad Sci U S A. 2013 Feb
19;110(8):2775-80. doi: 10.1073/pnas.1213962110. Epub 2013 Feb 6. PubMed PMID:23388640; PubMed Central PMCID: PMC3581972.
Structured Information