|
|
| Line 56: |
Line 56: |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os07g0678600|
| |
| − | Description = Similar to Serine/threonine protein kinase|
| |
| − | Version = NM_001067171.1 GI:115474074 GeneID:4344287|
| |
| − | Length = 2711 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os07g0678600, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
| |
| − | AP = Chromosome 7:29386976..29389686|
| |
| − | CDS = 29387228..29388559|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008400:29386976..29389686
| |
| − | source=RiceChromosome07
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008400:29386976..29389686
| |
| − | source=RiceChromosome07
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggcggagcagagaggaaatatgttgatgaaaaagtatgagatggggaaattactcgggcaaggaacctttgccaaggtttaccatgcccgtaacaccgagacttctgagagtgttgctatcaagatgattgataaagagaaggttttgaaaggcgggctcatggatcagatcaaacgtgagatttctgtgatgaagttggtgaggcatccaaacattgtgcagttatatgaggtcatggctaccaagactaagatatattttgtgctggagcacgtcaaaggtggagagttgttcaacaaagttcagagaggaagactaaaggaagatgcagcaaggaagtacttccaacaactgatttgcgctgttgacttttgccacagcaggggtgtttatcaccgtgatttgaagccagaaaatcttcttcttgatgagaacagcaatctgaaggtttcagattttggcctaagtgctcttgctgattgcaaaagacaggatgggctgctccacacaacctgtggcacacctgcttatgttgctccagaagtgatcaacagaagaggctatgacggtgctaaggctgacatatggtcttgtggagtgatactctttgtgctattggccggctatctacctttccatgataagaacttgatggatatgtataagaagattgggaaagcagaattcaaatgtccaagttggtttaataccgatgttcgaaggctcttgctcaggatacttgatcctaacccaagtacaaggatctcaatggacaaaatcatggaaaatccttggtttaggaagggtctcgatgcaaagctgctcagatataatctacaaccaaaggatgcaattcctgttgatatgagcacagattttgactccttcaatagcgctccaacattggagaagaagccgtccaacttgaatgcttttgatataatttctttgtcaactggacttgacctctctggtatgtttgaggagtctgataagaaagagtccaaattcacatccaccagtacagcttcaacaatcatatctaagattgaggatattgccaagggcttgcggttgaagctcacaaagaaagatggtggactgttgaagatggaaggctccaagcctggaaggaaaggtgttatgggcattgatgcagagatattcgaggttaccccaaactttcatcttgtggagctaaagaagacaaatggtgatacacttgaataccgtaaggtcttgaaccaagagatgagaccagctttgaaggacatagtctgggcttggcagggtgagcaaccgaagcagcagcagcagccaacgtgctaa</cdnaseq>|
| |
| − | AA = <aaseq>MAEQRGNMLMKKYEMGKLLGQGTFAKVYHARNTETSESVAIKMI DKEKVLKGGLMDQIKREISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKV QRGRLKEDAARKYFQQLICAVDFCHSRGVYHRDLKPENLLLDENSNLKVSDFGLSALA DCKRQDGLLHTTCGTPAYVAPEVINRRGYDGAKADIWSCGVILFVLLAGYLPFHDKNL MDMYKKIGKAEFKCPSWFNTDVRRLLLRILDPNPSTRISMDKIMENPWFRKGLDAKLL RYNLQPKDAIPVDMSTDFDSFNSAPTLEKKPSNLNAFDIISLSTGLDLSGMFEESDKK ESKFTSTSTASTIISKIEDIAKGLRLKLTKKDGGLLKMEGSKPGRKGVMGIDAEIFEV TPNFHLVELKKTNGDTLEYRKVLNQEMRPALKDIVWAWQGEQPKQQQQPTC</aaseq>|
| |
| − | DNA = <dnaseqindica>1128..2459#attgctgcgccgtgctcgaacagatctcgatctcgatctcgatctccgcacgcaccaaggcgaagccaattccactaccaccgctcttccttcttctcactccttctcgcgactgcggcgagggtgagtctcctgtcgtgagaatttcggtctaccggcggcggcggcggcgttgggtgttcttcgcgtcgtcagacgtcgggatctggtacggttctccttatctctggttgttgataatctatatggatctatggtttgttgattcgtctgtatgtgaaaaacatcatcttgggttagcgaggggtgggtttcagattctcaggtcgagtctccagtacactggttgagtgctcgtttctagatctgtatttgttctgcaacgcgaggtgttgtggttgatgcgattcatgcgaaaacttaatctgtcatacatacttggaagggtaaaaaaagaaaaaaataatctcctttctactggagatgcatagcgtgggaattataattagcctcttgttatctgctagcctggttgttgagcgaagctttcggatccaaccttttaattcagggtagctttatgtagtacagaaaactgtgtaactgtattgtgtttcctgttactttcttttaaaacaagttctggttgaaaagcgtagaaacagtcttaactggcatgtcttgttttcatgcatatgtgctgtgcagtagattaatccttttacctagaacttctcaattgagttttatgttagttgattccaactagtagttgtccatgactgaccttattgcatcttcttcttttggcagaattactagacttccaataagaaggaaacaccttagggaatgcagaaagatgtgcttgcatgctagagagctaccttgtgagggaattggcagggtagcaagccatatttctccttccacaactcttcatgacattggaacacaagagtatatacagcgcttgctccatgtgctctcgcactatggggttcgacgtggcaactcaaccatcttcttagatcaccatcttggtggagacggttgaagtcacctatcatttctaggctcctggttaccacactttgagctttgggattactgctttctttggcgtgatggcggagcagagaggaaatatgttgatgaaaaagtatgagatggggaaattactcgggcaaggaacctttgccaaggtttaccatgcccgtaacaccgagacttctgagagtgttgctatcaagatgattgataaagagaaggttttgaaaggcgggctcatggatcagatcaaacgtgagatttctgtgatgaagttggtgaggcatccaaacattgtgcagttatatgaggtcatggctaccaagactaagatatattttgtgctggagcacgtcaaaggtggagagttgttcaacaaagttcagagaggaagactaaaggaagatgcagcaaggaagtacttccaacaactgatttgcgctgttgacttttgccacagcaggggtgtttatcaccgtgatttgaagccagaaaatcttcttcttgatgagaacagcaatctgaaggtttcagattttggcctaagtgctcttgctgattgcaaaagacaggatgggctgctccacacaacctgtggcacacctgcttatgttgctccagaagtgatcaacagaagaggctatgacggtgctaaggctgacatatggtcttgtggagtgatactctttgtgctattggccggctatctacctttccatgataagaacttgatggatatgtataagaagattgggaaagcagaattcaaatgtccaagttggtttaataccgatgttcgaaggctcttgctcaggatacttgatcctaacccaagtacaaggatctcaatggacaaaatcatggaaaatccttggtttaggaagggtctcgatgcaaagctgctcagatataatctacaaccaaaggatgcaattcctgttgatatgagcacagattttgactccttcaatagcgctccaacattggagaagaagccgtccaacttgaatgcttttgatataatttctttgtcaactggacttgacctctctggtatgtttgaggagtctgataagaaagagtccaaattcacatccaccagtacagcttcaacaatcatatctaagattgaggatattgccaagggcttgcggttgaagctcacaaagaaagatggtggactgttgaagatggaaggctccaagcctggaaggaaaggtgttatgggcattgatgcagagatattcgaggttaccccaaactttcatcttgtggagctaaagaagacaaatggtgatacacttgaataccgtaaggtcttgaaccaagagatgagaccagctttgaaggacatagtctgggcttggcagggtgagcaaccgaagcagcagcagcagccaacgtgctaaaaaactttgacaagggcaagttttttgcaatttgagtcgacttccaatcgtttatgtatttctgcagcttttgttcctcttgttattcattttcattcctcatgtattgttaatattaatatcgatgctatcttcaaatgaggatttatttgaaaaaaatgttgagtttgtttctggatgttactgtttttgctcatggagaactgtaatactgacatttttcatttatcatgacgcaaaaagatgcatatt</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001067171.1 RefSeq:Os07g0678600]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Latest revision as of 08:49, 12 June 2015
OsCIPK2(OsCIPK02) is a member of CIPK genes (CIPKs,calcineurin B-like protein interacting protein kinases)[1][2].
Annotated Information
Function
- Interestingly, five OsCIPK genes, OsCIPK1, OsCIPK2, OsCIPK10, OsCIPK11 and OsCIPK12, were transcriptionally up-regulated after bacterial blight infection[1][2].
- OsCIPK2 was induced by cold and Bacterial blight. It is involved in the biotic stress[1].
GO assignment(s): GO:0004672,GO:0004674, GO:0006468, GO:0005524, GO:0007165
Expression
Figure 1. Validation of diurnal expression patterns for OsCIPK2.(from reference
[3]).
- By the RT-PCR-based cDNA cloning approach, 15 CIPK genes were cloned from stress-treated seedlings of Nipponbare. Among them, 10 genes (OsCIPK2, OsCIPK5, OsCIPK10, OsCIPK11, OsCIPK12, OsCIPK14, OsCIPK15, OsCIPK18, OsCIPK25 and OsCIPK26) were intron-less, and other five genes (OsCIPK1, OsCIPK3, OsCIPK7, OsCIPK23 and OsCIPK24) were intron-rich, consistent with the previous data[1][2].
- OsCIPK2 was up-regulated in both roots and shoots, it was also up-regulated in leaves of treated plants. OsCIPK2 was highly expressed 12 h after inoculation with PXO99, clearly indicating that it was probably involved in the early events of rice disease response[1].
- OsCIPK02 showed ubiquitous expression in all tissues/organs[3], OsCIPK02 containing DRE in their promoter regions was actually induced by drought[2].
- Real-time RT-PCR analysis confirmed the diurnal expression patterns showing a peak at daytime and a downregulation in the osgi mutant for the three marker genes and nine of the OsCIPK genes, OsCIPK02 is a member of these nine genes (Fig. 1), which indicating that OsCIPK02 might function downstream of OsGI[3].
Evolution
OsCIPK02 belongs to subgroup III, the others are: OsCIPK05, OsCIPK10, OsCIPK11, OsCIPK14, OsCIPK15, OsCIPK18, OsCIPK20, OsCIPK26, and OsCIPK28[3].
Knowledge Extension
Figure 2. Functional gene network analysis of OsCIPK family members.(from reference [3]).
- From real-time RT-PCR analyses, Giong et al. identified 16 OsCIPK genes showing a significant up- or down-regulation in response to drought stress. Using the probable functional gene network tool, RiceNet, Giong et al. generated a hypothetical functional gene network based on 15 out of 16 OsCIPK proteins (Fig. 2)[3].
- More than 200 interactions mediated by these OsCIPK proteins. This network was further refined by integrating fold change data showing at least 1 log2-fold up-regulation (red colored nodes in Fig. 2) or less than -1 log2-fold down-regulation (green colored nodes in Fig. 2) under drought stress to all the elements in this network[3].
- Integrated subcellular localization data further enhances the feasibility of functional modules consisting of co-expressed functional groups such as CIPK and PPC and other components in the network(Fig. 1)[3].
- The calcineurin B-like protein–CBL-interacting protein kinase (CBL–CIPK) signaling pathway in plants is a Ca2+-related pathway that responds strongly to both abiotic and biotic environmental stimuli[4]. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells[4].
Labs working on this gene
- National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China
- Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
- Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea
- State Key Laboratory of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing 210095, China
- College of Chemistry and Life Sciences, Zhejiang Normal University, Jinhua 321004, China
References
- ↑ 1.0 1.1 1.2 1.3 1.4
CHEN X, GU Z, LIU F, et al. Molecular Analysis of Rice CIPKs Involved in Biotic and Abiotic Stress Responses[J]. Chinese Journal of Rice Science, 2010, 6: 003.
- ↑ 2.0 2.1 2.2 2.3
Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
- ↑ 3.0 3.1 3.2 3.3 3.4 3.5 3.6 3.7
Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
- ↑ 4.0 4.1
Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J]. Plant cell reports, 2014, 33(2): 203-214.
Structured Information