Difference between revisions of "Os02g0630300"

From RiceWiki
Jump to: navigation, search
(Function)
 
(16 intermediate revisions by 2 users not shown)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
The semidwarf mutant M58817, designated as GA2ox9ACT,carries a T-DNA insertion at a position 2.4 kb upstream of the translation start codon of GA2ox9 (Figure 5D). Accumulation of GA2ox9 mRNA was significantly enhanced by T-DNA activation tagging, and the semidwarf phenotype was observed in both the homozygous and heterozygous mutants. The GA2ox9ACT homozygous mutant had an average plant height of 76% and produced seeds with an average fertility of 92% of the wild type(Table 1)GA2ox9ACT displayed a normal height but had longer roots and higher tiller numbers than the wild type (Table 1).
 +
[[File:1-f5dd.png |center |thumb |10000px |''''''Figure 5. Severely Dwarfed and Semidwarfed Rice Mutants Obtained by T-DNA Activation Tagging.(D) The semidwarf mutant GA2ox9ACT (M58817).'''''']]
 +
[[File:1-t1.png |center |thumb |10000px ]]
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
Genes GA2ox9 was expressed in leaves, and its expression was also temporally regulated (Figure 3B).GA2ox9 accumulation of its mRNAs in leaves was detected prior to the transition from vegetative to reproductive growth phases.Since expression of most GA2oxs terminated after the active tillering stage, the pattern of tiller growth throughout the rice life cycle was examined. Tiller number increased from 30 to 50 DAI (active tillering), remained constant until 75 DAI, and then increased again until 90 DAI (late tillering)when the experiment was terminated (Figure 3C). Expression of each group of GA2oxs paralleled the active and late tillering stages (cf. Figures 3B with 3C). Germination was observed from 1 DAI and reached almost 100% at 2 DAI (Figure 4A). The accumulation of most GA2ox mRNAs was detectable starting from 0 to 1 DAI and maintained at similar levels afterward, except that of GA2ox5 and GA2ox9 was moderately reduced at 2 DAI (Figure 4B).
 +
[[File:1-f3b.png |left |thumb |10000px |''''''Figure 3. Differential Expression of Two Groups of GA2oxs Regulates Flower and Tiller Development.(B) Temporal expression patterns of GA2oxs in rice. The last fully expanded leaves were collected from rice plants at different developmental stages. Total RNA was isolated and analyzed by RT-PCR using GA2ox and GA3ox2 gene-specific primers (see Supplemental Table 4 online). The 18S rRNA gene (rRNA) was used as a control.'''''']]
 +
[[File:1-f4b.png |center |thumb |10000px |''''''Figure 4. C20 GA2oxs Could Be Responsible for Regulating Seed Germination.(B) Expression patterns of GA2oxs in rice seedlings between 0 and ;5 DAI. Total RNA was isolated from embryos at each time point and
 +
analyzed by RT-PCR. The 18S rRNA gene (rRNA) was used as a control.'''''']]
 +
<br>
 +
[[File:1-f3c.png |left |thumb |10000px |''''''Figure 3. Differential Expression of Two Groups of GA2oxs Regulates Flower and Tiller Development.(C) Tiller development during the life cycle of rice. A total of eight plants were used for counting tiller number, and error bars indicate the SE of the mean at each time point.'''''']]
 +
[[File:1-f4a.png |center |thumb |10000px |''''''Figure 4. C20 GA2oxs Could Be Responsible for Regulating Seed Germination.(A) Germination rate of rice seeds reached 100% at 2 DAI.'''''']]
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
 +
<br>
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
[[File:1-f1.png |center |thumb |10000px |''''''Figure 1. Phylogenetic Tree Based on the Comparison of Plant GA2oxs.Amino acid sequences of 29 GA2oxs from nine plant species (see Supplemental Table 3 online). Plant species: At, Arabidopsis thaliana;Cm, Cucurbita maxima; Ls, Lactuca sativa; Nt, Nicotiana sylvestris; Pc,Phaseolus coccineus; PaPt, Populus alba 3 P. tremuloides; Ps, Pisum sativum; So, Spinacia oleracea. The scale value of 0.1 indicates 0.1 amino acid substitutions per site.'''''']]
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Institute of Molecular Biology, National Chung-Hsing University, Taichung 402, Taiwan, Republic of China
 +
*Institute of Molecular Biology, Academia Sinica, Taipei 115, Taiwan, Republic of China
 +
*Institute of Plant and Microbial Biology, Academia Sinica, Taipei 115, Taiwan, Republic of China
 +
*Department of Energy Plant Research Laboratory and Department of Plant Biology, Michigan State University,East Lansing, Michigan 48824-1312
 +
<br>
  
 
==References==
 
==References==
Line 20: Line 39:
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
GeneName = Os02g0630300|
 
Description = Similar to Gibberellin 2-oxidase 3|
 
Version = NM_001186155.1 GI:297721442 GeneID:9266251|
 
Length = 2654 bp|
 
Definition = Oryza sativa Japonica Group Os02g0630300, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:26086366..26089019|
 
CDS = 26086624..26086884|
 
GCID = <gbrowseImage1>
 
name=NC_008395:26086366..26089019
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:26086366..26089019
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>cgtttttccgactctacttctattttgaaggcgtggagcaacaacaggtacaagagcgtggagcacagggtgatgacgaacgcgacgacggagagatactccgtcgcctacttcctctgcccgtcgtacgactcgcccatcggcacgtgcagggagccttccccttacaaggcgttcaccttcggggagtacaggcgaagggtgcaggaagacgtcaagaagacggggaagaagactggcctcagtaatttcctcgtatga</cdnaseq>|
 
AA = <aaseq>RFSDSTSILKAWSNNRYKSVEHRVMTNATTERYSVAYFLCPSYD                    SPIGTCREPSPYKAFTFGEYRRRVQEDVKKTGKKTGLSNFLV</aaseq>|
 
DNA = <dnaseqindica>2136..2396#acgcaccactagcaccgtatccatatatatacaacgcacttacccacccatgagtcgacgagtttatctctttatcgtacgtctaaagattaaaaaacattagttttgtattaaaaacatactcacctatatgtaacatttgattatttatgatcactatgatttaatccttacaaattgaaacacgtggtacactctaattaaactggtactttagttgtaggaagttatcaaaagtcaacaacacaaaaatacggtccgcttttcaggagctctttagttatgggtaaacaatttgtacagtacggaggggaaacatgtgtacatatgaaatataaaaccatttgttaccaccgttaatccacctttttttatgtttaccttgatccaacaaaagaaatattccaggacctaacatatattagaatagagagggtttcaggtcggcaaaacaacacagtacactgatttcgcaactaacaccatctagttgccgtgtgggggcggcgcagggacgtgacgcgggaggtggcggacgcgatgtcgaggctggccagggcgctggcgcgcgtgctggcggagagcctcctgggccacgccgccggcgagcgattcccggaggggtgcgacgacgcgacgtgcttcctccggctgaaccgctacccgccgtgccccttcccaccggacgacgccttcggcctggtcccgcacaccgacagcgacttcctcaccgtgctctgccaggaccacgtcggcggcctgcagctcatgaagggctcccgctgggtcgccgtcaagcccatccccggcgccctcatcgtcaacatcggagacctttttcaggtacacccattaactccaacgttgtataaacatctcaacacaaatccctaaataccatatatgcataatggtactaagatggaagagagaaaacaaaagagaaaaagaggatgagtcaccccctcataaagagaaaaatatggcgctgattggatgaaaagtgcatgaaacaaatagttttcttgtattggagctagtatattagagataatgtgtagtatattttacctcctaataattaattagttgatgatgtggataatattaagggtgacaatcatccctactataaaacttgctgttacacctaatcatgcataccactcgtgctatatatagtgctatatacccaatcaacaactactccatattctacgaagctttgcacgggagaggagaaaaaaatgtgcataattattttggacaaggcgagtacaatacaggctctcgtggctggccggccggctggctggctggctggctgcggccggcaatgctttccaacctgtagagtcaaagcctgcatctgcctatggtaggtggtttgtctgtctgcgtgaaaaagtacagattccgtgaacatattccgggcctccggctctccaaaaggcggacgttgcagcgtcacgctttgcgtacttgtgcttgtgggcatgtcgtgcctatctatcagcagccttgcctgcgtgtatcgctgtaccgccgctagcgaaaaaaaaaaaaggctgcggattccgctatgatcaagggacagaaaaacatcgtgcaaaagggctagtagaatggaaagatcgacttgtcagttacactcacatggtacatttgcgacttttgctagggaacttgatcggtcacgataacatagtactactactattgtactactatatcgtgctataactagagtctaaaagaaatctctcaatctatgcctatgcccaacaacacgttctaagaaaatatctacgttagtcagaaaatagtacataaatctaaagcatatacttacatcttgggaggaccaaattataacagtttaggcaccatttgaatgtgataagcttaagcttattacagcacgaaaatgtagtggatgattaaagcatgattaattactaagtattaaccattgtaaacttattttttaaaaaaaaaatctatatattttttttcatgaaacatacaaatgtgaatcattaaattaagcatcagtggacagtgtatgcgaggccgtactaaacttatactctaccacgttgaaccaaattagggcggttcaattcaattcctgacgtttttccgactctacttctattttgaaggcgtggagcaacaacaggtacaagagcgtggagcacagggtgatgacgaacgcgacgacggagagatactccgtcgcctacttcctctgcccgtcgtacgactcgcccatcggcacgtgcagggagccttccccttacaaggcgttcaccttcggggagtacaggcgaagggtgcaggaagacgtcaagaagacggggaagaagactggcctcagtaatttcctcgtatgaggcgcacacaaattcagtggccggccagtttcagttccgttctgtgtatcatcagtaaatgtacaattattaatgactaagagtgcagtacattaattaattaattaattagtttattgtagcttagtttgacggtgtacaagtactggtaggagattgccggtatatatgtacgtaggaaataagataagggatccatgtacagtttatgtacggccttcgatcccttgtcctttggtttgaattatgatgtttctt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001186155.1 RefSeq:Os02g0630300]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 07:30, 26 July 2016

Please input one-sentence summary here.

Annotated Information

Function

The semidwarf mutant M58817, designated as GA2ox9ACT,carries a T-DNA insertion at a position 2.4 kb upstream of the translation start codon of GA2ox9 (Figure 5D). Accumulation of GA2ox9 mRNA was significantly enhanced by T-DNA activation tagging, and the semidwarf phenotype was observed in both the homozygous and heterozygous mutants. The GA2ox9ACT homozygous mutant had an average plant height of 76% and produced seeds with an average fertility of 92% of the wild type(Table 1)GA2ox9ACT displayed a normal height but had longer roots and higher tiller numbers than the wild type (Table 1).

'Figure 5. Severely Dwarfed and Semidwarfed Rice Mutants Obtained by T-DNA Activation Tagging.(D) The semidwarf mutant GA2ox9ACT (M58817).'
1-t1.png

Expression

Genes GA2ox9 was expressed in leaves, and its expression was also temporally regulated (Figure 3B).GA2ox9 accumulation of its mRNAs in leaves was detected prior to the transition from vegetative to reproductive growth phases.Since expression of most GA2oxs terminated after the active tillering stage, the pattern of tiller growth throughout the rice life cycle was examined. Tiller number increased from 30 to 50 DAI (active tillering), remained constant until 75 DAI, and then increased again until 90 DAI (late tillering)when the experiment was terminated (Figure 3C). Expression of each group of GA2oxs paralleled the active and late tillering stages (cf. Figures 3B with 3C). Germination was observed from 1 DAI and reached almost 100% at 2 DAI (Figure 4A). The accumulation of most GA2ox mRNAs was detectable starting from 0 to 1 DAI and maintained at similar levels afterward, except that of GA2ox5 and GA2ox9 was moderately reduced at 2 DAI (Figure 4B).

'Figure 3. Differential Expression of Two Groups of GA2oxs Regulates Flower and Tiller Development.(B) Temporal expression patterns of GA2oxs in rice. The last fully expanded leaves were collected from rice plants at different developmental stages. Total RNA was isolated and analyzed by RT-PCR using GA2ox and GA3ox2 gene-specific primers (see Supplemental Table 4 online). The 18S rRNA gene (rRNA) was used as a control.'
'Figure 4. C20 GA2oxs Could Be Responsible for Regulating Seed Germination.(B) Expression patterns of GA2oxs in rice seedlings between 0 and ;5 DAI. Total RNA was isolated from embryos at each time point and analyzed by RT-PCR. The 18S rRNA gene (rRNA) was used as a control.'


'Figure 3. Differential Expression of Two Groups of GA2oxs Regulates Flower and Tiller Development.(C) Tiller development during the life cycle of rice. A total of eight plants were used for counting tiller number, and error bars indicate the SE of the mean at each time point.'
'Figure 4. C20 GA2oxs Could Be Responsible for Regulating Seed Germination.(A) Germination rate of rice seeds reached 100% at 2 DAI.'










Evolution

'Figure 1. Phylogenetic Tree Based on the Comparison of Plant GA2oxs.Amino acid sequences of 29 GA2oxs from nine plant species (see Supplemental Table 3 online). Plant species: At, Arabidopsis thaliana;Cm, Cucurbita maxima; Ls, Lactuca sativa; Nt, Nicotiana sylvestris; Pc,Phaseolus coccineus; PaPt, Populus alba 3 P. tremuloides; Ps, Pisum sativum; So, Spinacia oleracea. The scale value of 0.1 indicates 0.1 amino acid substitutions per site.'

Labs working on this gene

  • Institute of Molecular Biology, National Chung-Hsing University, Taichung 402, Taiwan, Republic of China
  • Institute of Molecular Biology, Academia Sinica, Taipei 115, Taiwan, Republic of China
  • Institute of Plant and Microbial Biology, Academia Sinica, Taipei 115, Taiwan, Republic of China
  • Department of Energy Plant Research Laboratory and Department of Plant Biology, Michigan State University,East Lansing, Michigan 48824-1312


References

Please input cited references here.

Structured Information