Difference between revisions of "Os05g0276500"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
 
(3 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os05g0276500''''' was reported as '''''OsEXPA3''''' in 2014 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os02g0649300''''' '''''<=>''''' '''''OsEXPA3'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* '''''OsEXPA3''''' is required for root system development in rice and involved in mediating root growth by mediating cell-wall loosening
 +
* '''''OsEXPA3''''' is a critical root expansin gene that is intrinsically involved in root system architecture adapted to some abiotic stresses.
 +
* Modification of cell-wall compositions mediated by '''''OsEXPA3''''' repression changed the wall mechanical properties, which elucidated the cell loosening process both biochemically and mechanically.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* Semiquantitative-PCR analysis demonstrated that '''''OsEXPA3''''' expressed preferentially in the root of 1-wk- old seedlings.
 +
* Expressing preferentially in the root throughout the whole developmental stages, '''''OsEXPA3''''' displayed the expression peak in 1-wk-old seedlings but decreased drastically at the tillering stage, and the expression diminution continued with the passage of growth time.
 +
* As to abiotic stresses and nutrient deficiency, '''''OsEXPA3''''' expression in the root was significantly upregulated by NaCl stress, while repressed by N and Pi deficiency. The result implies an intrinsic function of '''''OsEXPA3''''' in regulation of the root system architecture in response to abiotic stresses.<br><br>
  
===Evolution===
+
[[File:6-Os02g0649300-1.png|center|thumb|800px|'''Figure 3.''' ''Effects of OsEXPA3 downregulation on the root system architecture. (a) Primary root length of 1-wk-old seedlings. (b) Lateralroot density of 1-wk-old seedlings. Two independent transgenic lines (Line 1 and Line 3) were analyzed. The seeds were placed on half-strength Murashige and Skoog solid medium and grown for 7 d vertically in a growth chamber. Primary root length was determined using a ruler. All visible lateral roots that emerged from the primary root were counted. Values are the means of 20 biological replications
Please input evolution information here.
+
± standard error. One independent plant was considered as one biological replication.<ref name="ref1" />.'']]
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
Os05g0276500 locate at the chromosome5,it's gene type is protein coding,and expression information at root and stem.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Key Lab. of Biorheological Science and Technology, Ministry of Education, Bioengineering College, Chongqing Univ., Chongqing, 400030, P. R. China.
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Qiu, Shichun, et al. "Repression of Expression Leads to Root System Growth Suppression in Rice." Crop Science 54.5 (2014): 2201-2213.
 +
</ref>
 +
 
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
GeneName = Os05g0276500|
 
Description = Expansin Os-EXPA3|
 
Version = NM_001061612.1 GI:115462954 GeneID:4338278|
 
Length = 1781 bp|
 
Definition = Oryza sativa Japonica Group Os05g0276500, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
 
AP = Chromosome 5:11404176..11405956|
 
CDS = 11404443..11404752,11405334..11405655,11405755..11405890|
 
GCID = <gbrowseImage1>
 
name=NC_008398:11404176..11405956
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008398:11404176..11405956
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgctctctggaatggagaaacaacctgcaatgcttctcgttcttgtgacactctgcgccttcgcatgcaagcgatccgtcgcacagtctgcctttgccacgttctacggtggcaaggacgggtcgggcaccatgggtggcgcgtgtgggtacggtaacctgtacaacgccgggtacgggctgtacaacgcggcgctgagctcggcgctgttcaacgacggcgccatgtgcggcgcgtgctacaccatcacctgcgacaccagccagaccaagtggtgcaagcccggcggcaactccatcaccatcacggccaccaacttatgcccgcctaactgggcgctgcccagcaacagcggcgggtggtgcaacccaccgcggcagcacttcgacatgtcacagccggcctgggagaacatcgccgtctatcaagccggcattgtccccgtcaactacaagagggttccgtgccagaggagcggggggatccggttcgcgatcagcggtcacgactactttgagcttgtgaccgtgacgaacgtgggcggcagcggcgtggtggcgcagatgtcgatcaaggggtccaacacgggctggatggcgatgagcaggaattggggcgccaattggcagagcaacgcgtacctcgccgggcagagcctgtccttcattgtgcagctcgacgacggccgaaaggtcacggcctggaacgtcgccccgtccaactggttcttcggtgccacctactctacctcttgggtgcagttctga</cdnaseq>|
 
AA = <aaseq>MLSGMEKQPAMLLVLVTLCAFACKRSVAQSAFATFYGGKDGSGT                    MGGACGYGNLYNAGYGLYNAALSSALFNDGAMCGACYTITCDTSQTKWCKPGGNSITI                    TATNLCPPNWALPSNSGGWCNPPRQHFDMSQPAWENIAVYQAGIVPVNYKRVPCQRSG                    GIRFAISGHDYFELVTVTNVGGSGVVAQMSIKGSNTGWMAMSRNWGANWQSNAYLAGQ                    SLSFIVQLDDGRKVTAWNVAPSNWFFGATYSTSWVQF</aaseq>|
 
DNA = <dnaseqindica>1205..1514#302..623#67..202#acaaaacgaaaacctaaagaatcaccagccttgcaaaccaatcaacctgtctagattaatttttgcatgctctctggaatggagaaacaacctgcaatgcttctcgttcttgtgacactctgcgccttcgcatgcaagcgatccgtcgcacagtctgcctttgccacgttctacggtggcaaggacgggtcgggcaccatgggtacgtacatttcaagcttaatttgatattttctcaaacaaattagctgatgatgatgatgccatttctgaacttggatgtacgtgcgacgcgatgcaggtggcgcgtgtgggtacggtaacctgtacaacgccgggtacgggctgtacaacgcggcgctgagctcggcgctgttcaacgacggcgccatgtgcggcgcgtgctacaccatcacctgcgacaccagccagaccaagtggtgcaagcccggcggcaactccatcaccatcacggccaccaacttatgcccgcctaactgggcgctgcccagcaacagcggcgggtggtgcaacccaccgcggcagcacttcgacatgtcacagccggcctgggagaacatcgccgtctatcaagccggcattgtccccgtcaactacaagaggtacatgcatcctactcctagttgaataatagccgaaatcgttatagatcaaagatcaatcggagatatatatatgtttgaagtgtttttttttactcgaattgatatacacactcactagctagctcatgaaggcacatcgataacgggtctagaaggattataggttcatgcttgtttcatgctagcaccaatttttcagtaccaatgctatcgatcactagttctagttttgaaacggcttatatgtatcgatactagtgtaaaaccagtacctaccagactaccagagatgggctaacagactcaaagcaggtactgtaatagactataaatcggctacaaacttatgtagagtagataagagaggagagataagagaagcggactacttagccagctgcagcacgtacatagatactgacgatgatttggagctagtaatttactatactattaaacttgctctcataattaccggtgctagactagaaacggcacctataatctgacataggtgcacacagctagtagtaaggtttctcaaaaaacctcacaaatgctgcttgtgtccaatgcagggttccgtgccagaggagcggggggatccggttcgcgatcagcggtcacgactactttgagcttgtgaccgtgacgaacgtgggcggcagcggcgtggtggcgcagatgtcgatcaaggggtccaacacgggctggatggcgatgagcaggaattggggcgccaattggcagagcaacgcgtacctcgccgggcagagcctgtccttcattgtgcagctcgacgacggccgaaaggtcacggcctggaacgtcgccccgtccaactggttcttcggtgccacctactctacctcttgggtgcagttctgaagtactgcaacgtacgtacaggtttagttgataaattatacacatgctgttcatggacataattaattaattactagccatcccggccgtttgtgcatgttctgctaggttgtgtgttgcgtggcattaacttgtttttctctgttaccagtcgttttgtcaaacgcgttggttgtggcaagcgcgattgaatgttttgcccaccaattaatgtaactgatcgtatgggtgttgagttaataaattatgtttaattatgcggatgcc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001061612.1 RefSeq:Os05g0276500]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 5]]
 
[[Category:Chromosome 5]]
 

Latest revision as of 11:18, 3 October 2016

The rice Os05g0276500 was reported as OsEXPA3 in 2014 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os02g0649300 <=> OsEXPA3

Function

  • OsEXPA3 is required for root system development in rice and involved in mediating root growth by mediating cell-wall loosening
  • OsEXPA3 is a critical root expansin gene that is intrinsically involved in root system architecture adapted to some abiotic stresses.
  • Modification of cell-wall compositions mediated by OsEXPA3 repression changed the wall mechanical properties, which elucidated the cell loosening process both biochemically and mechanically.

Expression

  • Semiquantitative-PCR analysis demonstrated that OsEXPA3 expressed preferentially in the root of 1-wk- old seedlings.
  • Expressing preferentially in the root throughout the whole developmental stages, OsEXPA3 displayed the expression peak in 1-wk-old seedlings but decreased drastically at the tillering stage, and the expression diminution continued with the passage of growth time.
  • As to abiotic stresses and nutrient deficiency, OsEXPA3 expression in the root was significantly upregulated by NaCl stress, while repressed by N and Pi deficiency. The result implies an intrinsic function of OsEXPA3 in regulation of the root system architecture in response to abiotic stresses.

Figure 3. Effects of OsEXPA3 downregulation on the root system architecture. (a) Primary root length of 1-wk-old seedlings. (b) Lateralroot density of 1-wk-old seedlings. Two independent transgenic lines (Line 1 and Line 3) were analyzed. The seeds were placed on half-strength Murashige and Skoog solid medium and grown for 7 d vertically in a growth chamber. Primary root length was determined using a ruler. All visible lateral roots that emerged from the primary root were counted. Values are the means of 20 biological replications ± standard error. One independent plant was considered as one biological replication.[1].

You can also add sub-section(s) at will.

Labs working on this gene

  • Key Lab. of Biorheological Science and Technology, Ministry of Education, Bioengineering College, Chongqing Univ., Chongqing, 400030, P. R. China.

References

  1. 1.0 1.1 Qiu, Shichun, et al. "Repression of Expression Leads to Root System Growth Suppression in Rice." Crop Science 54.5 (2014): 2201-2213.

Structured Information