Difference between revisions of "Os01g0178300"

From RiceWiki
Jump to: navigation, search
(Subcellular localization)
 
(8 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os01g0178300''''' was reported as '''''OsCDT3''''' in 2013 <ref name="ref1" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os01g0178300''''' '''<=>''' '''''OsCDT3,CDT3'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* '''''OsCDT3''''' encodes a predicted peptide of only 53 amino acid residues rich in cysteine.
 +
* '''''OsCDT3''''' anchoring to the plasma membrane may play a role in stopping entry of Al into the root cells by binding Al, therefore, contributing to high Al tolerance in rice.
 +
===Phenotypic analysis===
 +
* Knockdown of this gene resulted in decreased tolerance to Al, but did not affect the tolerance to Cd. The aluminum (Al) content in the root residues including cell wall and the plasma membrane of knockdown lines decreased, but the Al concentration in the root cell sap increased compared with those of the wild-type rice.
 +
===Expression===
 +
* The expression of '''''OsCDT3''''' was low in both the roots and shoots in the absence of Al [Figure 3(a)]. However, in the presence of Al, the expression was up-regulated by six times in the roots, but not in the shoots [Figure 3(a)]. Spatial expression analysis showed that '''''OsCDT3''''' was expressed in both the root tips (0–1 cm) and mature regions (1–2 cm) and the expression in both segments are up-regulated by Al [Figure 3(b)].
 +
* A time-course experiment showed that induction of '''''OsCDT3''''' occurred at 3 h after the exposure to Al and reached the maximum at 12 h [Figure 3(d)]. Furthermore, the expres- sion of '''''OsCDT3''''' is specifically induced by Al, but not by other metals including Cd and La, and by low pH [Figure 3(e)].
  
===Expression===
+
===Subcellular localization===
Please input expression information here.
+
* The subcellular localization of '''''OsCDT3''''' was examined by transiently expressing GFP-tagged '''''OsCDT3''''' in onion epidermal cells. One of the rice homologs, '''''OsCDT1''''', was reported to be localized at the plasma membrane and secreted outside the cells where it associates with the cell wall
 +
* Unlike '''''OsCDT1''''', '''''OsCDT3''''' is not secreted out of the cells, but anchored to the plasma membrane.<br><br>
  
===Evolution===
+
[[File:Os01g0178300.png|center|thumb|727px|'''Figure 6.''' ''Subcellular localization of OsCDT3.<ref name="ref1" />.'']]
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Institute of Plant Science and Resources, Okayama University, Chuo 2-20-1, Kurashiki, Japan
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Xia J, Yamaji N, Ma JF. A plasma membrane-localized small peptide is involved
 +
in rice aluminum tolerance. Plant J. 2013 Oct;76(2):345-55. doi:
 +
10.1111/tpj.12296. Epub 2013 Sep 6. PubMed PMID: 23888867.
 +
</ref>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
GeneName = Os01g0178300|
 
Description = Conserved hypothetical protein|
 
Version = NM_001185274.1 GI:297719682 GeneID:4323869|
 
Length = 973 bp|
 
Definition = Oryza sativa Japonica Group Os01g0178300, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:4065347..4066319|
 
CDS = 4065623..4065698,4066133..4066218|
 
GCID = <gbrowseImage1>
 
name=NC_008394:4065347..4066319
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:4065347..4066319
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgtacaaccctccggcggcgcaggagatgtcctactccgaccatgtcaagaagcgccatgaggacaaaggctgcctctatgcatgcctgttcaccctctgctgctgcttctgctgctacgagacctgcgagtgctgcctcgaatgcctctgctgctgctga</cdnaseq>|
 
AA = <aaseq>MYNPPAAQEMSYSDHVKKRHEDKGCLYACLFTLCCCFCCYETCE                    CCLECLCCC</aaseq>|
 
DNA = <dnaseqindica>622..697#102..187#atgctctgttagtgccttctgtctatctatcccccttgctggtttcttcctcctcttctgcgtcgtcgacttcgtctccggcggccgcggcacgggcggcgatgtacaaccctccggcggcgcaggagatgtcctactccgaccatgtcaagaagcgccatgaggacaaaggctgcctctatgcatggtgatcctcttcttctgtcatgctcttctaatctttcagagaagctgttgatgctattttatgttgcttattaatttggatgtcatctaaactaggttatattctctagattaggatgtgatctaaggtatttttcaaagtagaaattaggacatgtttgttcatcttggatgcactgttcaacatttctcaaatcatcagatagttcatctagtttcttcagacaagctgatttctgcatcatgtgagcattgaacacactcctaaagtcctactagattcagagatggatgagctgaagtagttagtggtcattttcatgtccaagaaaaccaaagatcatgtgagattttgccctgatcaagagggcttcttcaccatttgacaccttttttcctctgtttacctgtgatctctttccctttttgttgcagcctgttcaccctctgctgctgcttctgctgctacgagacctgcgagtgctgcctcgaatgcctctgctgctgctgatctccttatctcatttcagcagtcaaaataatgatgatgatatatcatatatagtcaggaataaaagatataatatgccgtttgaaatgcaggaatttatttttccgatttcaaaccatagtttgttgttgtatgtgtactggtgacaatatcatggtagatgaaactttctgaaaatttggtaggtatcagcaagatttgatctttttagttgtgctcccatctataaaatgaataaatatatttaagctgcctgccgagataaaattattaatc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001185274.1 RefSeq:Os01g0178300]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 1]]
 
[[Category:Chromosome 1]]
 

Latest revision as of 08:14, 8 October 2016

The rice Os01g0178300 was reported as OsCDT3 in 2013 [1] by researchers from Japan.

Annotated Information

Gene Symbol

  • Os01g0178300 <=> OsCDT3,CDT3

Function

  • OsCDT3 encodes a predicted peptide of only 53 amino acid residues rich in cysteine.
  • OsCDT3 anchoring to the plasma membrane may play a role in stopping entry of Al into the root cells by binding Al, therefore, contributing to high Al tolerance in rice.

Phenotypic analysis

  • Knockdown of this gene resulted in decreased tolerance to Al, but did not affect the tolerance to Cd. The aluminum (Al) content in the root residues including cell wall and the plasma membrane of knockdown lines decreased, but the Al concentration in the root cell sap increased compared with those of the wild-type rice.

Expression

  • The expression of OsCDT3 was low in both the roots and shoots in the absence of Al [Figure 3(a)]. However, in the presence of Al, the expression was up-regulated by six times in the roots, but not in the shoots [Figure 3(a)]. Spatial expression analysis showed that OsCDT3 was expressed in both the root tips (0–1 cm) and mature regions (1–2 cm) and the expression in both segments are up-regulated by Al [Figure 3(b)].
  • A time-course experiment showed that induction of OsCDT3 occurred at 3 h after the exposure to Al and reached the maximum at 12 h [Figure 3(d)]. Furthermore, the expres- sion of OsCDT3 is specifically induced by Al, but not by other metals including Cd and La, and by low pH [Figure 3(e)].

Subcellular localization

  • The subcellular localization of OsCDT3 was examined by transiently expressing GFP-tagged OsCDT3 in onion epidermal cells. One of the rice homologs, OsCDT1, was reported to be localized at the plasma membrane and secreted outside the cells where it associates with the cell wall
  • Unlike OsCDT1, OsCDT3 is not secreted out of the cells, but anchored to the plasma membrane.

Figure 6. Subcellular localization of OsCDT3.[1].

You can also add sub-section(s) at will.

Labs working on this gene

  • Institute of Plant Science and Resources, Okayama University, Chuo 2-20-1, Kurashiki, Japan

References

<references>

Structured Information

  1. 1.0 1.1 1.2 Xia J, Yamaji N, Ma JF. A plasma membrane-localized small peptide is involved in rice aluminum tolerance. Plant J. 2013 Oct;76(2):345-55. doi: 10.1111/tpj.12296. Epub 2013 Sep 6. PubMed PMID: 23888867.