Difference between revisions of "Os01g0678600"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os01g0678600| Description = Ribosomal protein S20 family protein| Version = NM_001050394.1 GI:115439158 GeneID:4325273| Length = 2018 bp| Defin...")
 
(Annotated Information)
 
(8 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os01g0678600''''' was reported as '''''ASL1''''' in 2013 <ref name="ref1" /> by researchers from China.  
GeneName = Os01g0678600|
 
Description = Ribosomal protein S20 family protein|
 
Version = NM_001050394.1 GI:115439158 GeneID:4325273|
 
Length = 2018 bp|
 
Definition = Oryza sativa Japonica Group Os01g0678600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
[[File:19-Os01g0678600.png|right|thumb|327px|'''Figure 1.''' ''Characterization of the asl1 mutants.<ref name="ref1" />.'']]
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
===Gene Symbol===
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
*'''''Os01g0678600''''' '''<=>''' '''''ASL1,OsASL1'''''
|
+
===Function===
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
+
* Plastid ribosomal proteins (PRPs) are essential for ribosome biogenesis, plastid protein biosynthesis, chloroplast differentiation, and early chloroplast development. * In their is study, the researchers identifies the first rice PRP mutant, asl1 (albino seedling lethality1), which exhibits an albino lethal phenotype at the seedling stage.
AP = Chromosome 1:29678164..29680181|
+
* '''''ASL1''''' is essential for chloroplast development in rice.
CDS = 29678196..29678343,29678425..29678630,29679657..29679893|
+
* '''''ASL1''''' is involved in the establishment of the transcription/translation apparatus and plastid-to-nucleus signaling.
GCID = <gbrowseImage1>
+
* '''''ASL1''''' plays an important role in rice seedlings, especially at early stages.
name=NC_008394:29678164..29680181
+
===Phenotypic analysis===
source=RiceChromosome01
+
* The asl1 mutant is an albino, seedling-lethal mutant isolated from japonica rice Jiahua1 irradiated with 60 Co gamma rays. Although asl1 seeds germinated, all leaves of mutant plants exhibited an albino phenotype (Figure 1A) and the seedlings did not survive past the four- leaf stage (Figure 1B).  
preset=GeneLocation
+
* In addition, the contents of Chl a, Chl b, and Car approached zero in asl1 mutant plants (Figure 1C). These results suggested that the albino phenotypes of the young asl1 seedlings are caused by the reduction in total Chl content.
</gbrowseImage1>|
+
 
GSID = <gbrowseImage2>
+
===Expression===
name=NC_008394:29678164..29680181
+
* The researchers used RT-PCR to examine the expression of ASL1 in WT plants (Figure 5A). The researchers detected a significantly high level of expression in young leaves, culms, and flag leaves but weak expression in roots and young panicles. The ASL1 transcript was substantially reduced in asl1 mutants, indicating that the mutation in ASL1 causes a decreased transcript level.
source=RiceChromosome01
+
* Light plays a major role in regulating '''''ASL1''''' expression.
preset=GeneLocation
+
===Subcellular localization===
</gbrowseImage2>|
+
* The ASL1 protein was predicted to localize to chloroplasts by ChloroP and TargetP.
CDNA = <cdnaseq>atggcgaccgccacctccacgctcttctccctctcctccctctccgcctctctcccttcccccgcgcagccagccccggcgtctctctccctccgcgccgtctccccgcgggcccgcctgtccgcctcctacgccgccttccccatcggtgggatcggggcatgggcggcggcgacgccggcgtcgtcggggaggtggaggaggaggggactggaggtggtgtgcgaggcggccaagaccggcaccgcgaccgggaggcgcccggactcggtcaagaagagggagcggcagaacgaccggcaccgcatccgcaaccatgcacgcaaggccgagatgcgcaccaggatgaagaaggttttgaaagcccttgaaaagctgagaaagaaagctgatgccacacctgaagatatcattcaaatagagaaatggatttctgaggcatacaaagccattgacaagacagtgaaggttggcgccatgcacaggaatactggtaaccatcgcaagtcccttcttgcgaggaggaagaaggccatcgagatactccgtggttggtatgttccaaacgctgaacctgctgctaccagctag</cdnaseq>|
+
* Subcellular localization analysis of '''''ASL1ASL1''''' protein is localized to the chloroplast.
AA = <aaseq>MATATSTLFSLSSLSASLPSPAQPAPASLSLRAVSPRARLSASY                    AAFPIGGIGAWAAATPASSGRWRRRGLEVVCEAAKTGTATGRRPDSVKKRERQNDRHR                    IRNHARKAEMRTRMKKVLKALEKLRKKADATPEDIIQIEKWISEAYKAIDKTVKVGAM                    HRNTGNHRKSLLARRKKAIEILRGWYVPNAEPAATS</aaseq>|
+
 
DNA = <dnaseqindica>33..180#262..467#1494..1730#ggtgctcctcgagctcactccgcaccgcagccatggcgaccgccacctccacgctcttctccctctcctccctctccgcctctctcccttcccccgcgcagccagccccggcgtctctctccctccgcgccgtctccccgcgggcccgcctgtccgcctcctacgccgccttccccatcggtaccacctccctctctctctctcctcgagagtgttcttcctttgctcttattcgtcggtgatgcgaaatgccttgttcaggtgggatcggggcatgggcggcggcgacgccggcgtcgtcggggaggtggaggaggaggggactggaggtggtgtgcgaggcggccaagaccggcaccgcgaccgggaggcgcccggactcggtcaagaagagggagcggcagaacgaccggcaccgcatccgcaaccatgcacgcaaggccgagatgcgcaccaggatgaagaaggtagtacataaaatgtggtgctgccctttctcgcattgcctatgatccagagctttccaatggttccatcccactgtaaaaaaaaatgatataggagtacttagttgcacattgcacgatacactgtgcagagagaatgggaaattaggcgtaattagctgcgtcagtgcgtcaatcagctcatgagcagagtttcttgttagtacgccttcttggaaatgtagatggatttatgtaatgtccactgtccactgtcaagctccaaaaatggagtgaatgtgattttaaaaggtgctgcttatttgaattatagtatcaaactagtaatgtacccatgctaacgctacggcgatactatgtgataatgtaaatcatacaaccaaaagatagtatgtattttagcaaatcagattaacttaagatacacaaaaaagaaaaaagactaaagataagaagagttatcttattgttactctccctagttatacatagttgacgtgtactcttcagtcataaatatttgatgttatggcacagtaaaactttaagagtctgacttgcaacataacaaaatcagtcttatatcataatcgatcagattttgtagcttagcatcatataatttgttttcatgatcgtaatgaggcagttcaaactaatttataccattgataccattttactataagaccacatcgagacaatggtaatattcaatatcaatggattataacatcatgttcgccaatcatctacataatgtagtagttacattgacatctcaaaggagaaaactactaaactgaatttaatttcgcagttacctttcatgtgaactatagttattctgtcaatctaatggatatgctattatgaaatttacctgttagagaagcaagaggggttcatttgttgtacatatattccttttggttcctctaaaataagttacacttttatgcagcattcaatattataagttctttctatggatatgaaataccataagccttgttctttgattaggttttgaaagcccttgaaaagctgagaaagaaagctgatgccacacctgaagatatcattcaaatagagaaatggatttctgaggcatacaaagccattgacaagacagtgaaggttggcgccatgcacaggaatactggtaaccatcgcaagtcccttcttgcgaggaggaagaaggccatcgagatactccgtggttggtatgttccaaacgctgaacctgctgctaccagctagtctattgacaaatcgtcttcaggaattcgcagcagattcattgtcaacacgtcttgccaattttggacatgcatatgttgtttaaggaattaaatagctttgttatattctctccattccaagcgatgtgtatacctttggtccatgttatgtgttcatgttcttgctctggaagccttgaaacagaactgggccaatacttttctcccacttctgttatccttcacatcagtgttgtaaaatgacaagctgaaatattttttttctatggtaaggatgttttcaaag</dnaseqindica>|
+
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050394.1 RefSeq:Os01g0678600]|
+
You can also add sub-section(s) at will.
}}
+
 
[[Category:Genes]]
+
==Labs working on this gene==
[[Category:Japonica mRNA]]
+
* Development Center of Plant Germplasm Resources, College of Life and Environmental Sciences, Shanghai Normal University, Shanghai 200234, China
[[Category:Oryza Sativa Japonica Group]]
+
* Institute of Crop Sciences, Chinese Academy of Agricultural Sciences, Beijing, 100081, China
[[Category:Japonica Genes]]
+
* Institute of Plant Physiology and Ecology, Shanghai Institute for Biological Sciences, Chinese Academy of Sciences, Shanghai 200032, China
[[Category:Japonica Chromosome 1]]
+
==References==
[[Category:Chromosome 1]]
+
<references>
 +
* <ref name="ref1">
 +
Gong X, Jiang Q, Xu J, Zhang J, Teng S, Lin D, Dong Y. Disruption of the rice
 +
plastid ribosomal protein s20 leads to chloroplast developmental defects and
 +
seedling lethality. G3 (Bethesda). 2013 Oct 3;3(10):1769-77. doi:
 +
10.1534/g3.113.007856. PubMed PMID: 23979931
 +
</ref>
 +
 
 +
</references>
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]

Latest revision as of 08:55, 8 October 2016

The rice Os01g0678600 was reported as ASL1 in 2013 [1] by researchers from China.

Annotated Information

Figure 1. Characterization of the asl1 mutants.[1].

Gene Symbol

  • Os01g0678600 <=> ASL1,OsASL1

Function

  • Plastid ribosomal proteins (PRPs) are essential for ribosome biogenesis, plastid protein biosynthesis, chloroplast differentiation, and early chloroplast development. * In their is study, the researchers identifies the first rice PRP mutant, asl1 (albino seedling lethality1), which exhibits an albino lethal phenotype at the seedling stage.
  • ASL1 is essential for chloroplast development in rice.
  • ASL1 is involved in the establishment of the transcription/translation apparatus and plastid-to-nucleus signaling.
  • ASL1 plays an important role in rice seedlings, especially at early stages.

Phenotypic analysis

  • The asl1 mutant is an albino, seedling-lethal mutant isolated from japonica rice Jiahua1 irradiated with 60 Co gamma rays. Although asl1 seeds germinated, all leaves of mutant plants exhibited an albino phenotype (Figure 1A) and the seedlings did not survive past the four- leaf stage (Figure 1B).
  • In addition, the contents of Chl a, Chl b, and Car approached zero in asl1 mutant plants (Figure 1C). These results suggested that the albino phenotypes of the young asl1 seedlings are caused by the reduction in total Chl content.

Expression

  • The researchers used RT-PCR to examine the expression of ASL1 in WT plants (Figure 5A). The researchers detected a significantly high level of expression in young leaves, culms, and flag leaves but weak expression in roots and young panicles. The ASL1 transcript was substantially reduced in asl1 mutants, indicating that the mutation in ASL1 causes a decreased transcript level.
  • Light plays a major role in regulating ASL1 expression.

Subcellular localization

  • The ASL1 protein was predicted to localize to chloroplasts by ChloroP and TargetP.
  • Subcellular localization analysis of ASL1ASL1 protein is localized to the chloroplast.


You can also add sub-section(s) at will.

Labs working on this gene

  • Development Center of Plant Germplasm Resources, College of Life and Environmental Sciences, Shanghai Normal University, Shanghai 200234, China
  • Institute of Crop Sciences, Chinese Academy of Agricultural Sciences, Beijing, 100081, China
  • Institute of Plant Physiology and Ecology, Shanghai Institute for Biological Sciences, Chinese Academy of Sciences, Shanghai 200032, China

References

  1. 1.0 1.1 Gong X, Jiang Q, Xu J, Zhang J, Teng S, Lin D, Dong Y. Disruption of the rice plastid ribosomal protein s20 leads to chloroplast developmental defects and seedling lethality. G3 (Bethesda). 2013 Oct 3;3(10):1769-77. doi: 10.1534/g3.113.007856. PubMed PMID: 23979931

Structured Information