Difference between revisions of "Os03g0140400"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
 
(5 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os03g0140400''''' was reported as '''''CYP96B4''''' in 2014 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:48-Os03g0140400.png|right|thumb|427px|'''Figure 4.''' ''Subcellular localization of pJIT163_hGFP::SD37 using ER-mCherry and Golgi-mCherry in rice protoplast cells.<ref name="ref1" />.'']]
 +
===Gene Symbol===
 +
*'''''Os03g0140400''''' '''''<=>''''' '''''CYP96B4,OsCYP96B4,SD37,OsSD37'''''
 
===Function===
 
===Function===
Please input function information here.
+
* Slight over-expression of '''''CYP96B4''''' in transgenic lines promotes plant growth, and RNA interference targeting '''''CYP96B4''''' in transgenic lines mimics the mutant phenotype
 +
* '''''CYP96B4'''''  may be an important regulator of plant growth that affects plant height in rice.
  
 +
===Phenotypic analysis===
 +
* The researchers identified a spontaneous rice dwarf mutant in the indica cultivar 3037 (Oryza sativa L ssp. indica cv. 3037). This mutant displayed a dwarf phenotype during all stages of development, from seedling to grain filling (Figure 1A, 1B).
 +
* All internodes of the sd37 mutant were shorter than those of the wild type (Figure 1C). At the heading stage, the mutant showed a 25–35% reduction in plant height compared to wild-type plants. We thus named this mutant semi-dwarf 37 (sd37). Furthermore, the sd37 mutant had smaller panicles and shorter rachises than the wild type (Figure 1D).
 +
* The grains of sd37 were shorter and wider than those of the wild type (Figure 1E; Table 1). Morphological measurements of the wild type and the sd37 mutant are shown in Table 1. In contrast, the root length of the mutant was equivalent to that of the wild type in young seedlings (Figure 1F).
 
===Expression===
 
===Expression===
Please input expression information here.
+
* '''''CYP96B4''''' was predominantly expressed in the shoot apical meristem and developing leaf and root maturation zone but not in the root apical meristem.
 
+
===Subcellular Localization===
===Evolution===
+
* Subcellular Localization analysis of '''''CYP96B4''''' showed that its protein was ER-localized protein.
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* State Key Laboratory of Plant Genomics, National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China
 +
* National Engineering Research Center for Vegetables, Beijing Academy of Agriculture and Forestry Sciences, Key Laboratory of Biology and Genetic Improvement of Horticultural Crops (North China), Beijing, China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Zhang J, Liu X, Li S, Cheng Z, Li C. The rice semi-dwarf mutant sd37, caused
 +
by a mutation in CYP96B4, plays an important role in the fine-tuning of plant
 +
growth. PLoS One. 2014 Feb 3;9(2):e88068. doi: 10.1371/journal.pone.0088068.
 +
eCollection 2014. PubMed PMID: 24498428
 +
</ref>
 +
</references>
 +
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 3]]
GeneName = Os03g0140400|
 
Description = Conserved hypothetical protein|
 
Version = NM_001186330.1 GI:297721790 GeneID:9270900|
 
Length = 1894 bp|
 
Definition = Oryza sativa Japonica Group Os03g0140400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:2201645..2203538|
 
CDS = 2202535..2203356|
 
GCID = <gbrowseImage1>
 
name=NC_008396:2201645..2203538
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:2201645..2203538
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>cgagagcaagtccagacaaggcggcggcggaggcggcgacaagcaatcggtcgccgacttgctttcctccttcctctgcgacgacgagatcgccggcagcgccgacgccgacgtgtacatcagggacatggcgatgaacctcctcgtcgccggccgcgacaccacgagctcggcgctgtcgtggttcttctacctcctctccacgaacccgcgcgtcgagcagaagctcctgcaggagctggcgcccatcgcttcccgcaagccgcagctgcagcaggggcggctcttccccggcaacggcggcatggtgacgttcgacgcgagcgaggtgaggaacctcctgtacctgcacgcggccctttgcgaggccatgaggctgtacccgccggtgcctttggagcacaaggcggcggtcgccgacgacgtgctccccagcgggcacgaggtgatggccggcgacaaggtgctggtgttctactactccatggggaggatgaagcgggtgtggggcaaggactgcagggagttcaggccggagcggtggatcaccgaggacggcaagctgcggtacgtgccgtcgaacaagttcgtcgcgttcaactccgggccgaggacatgcctcggcaaggagatggcgctcgtgcagatgaaggtcacggcggcggccatggcgtggaactttgccgtggaggtggtgccggggcacgtcgtggagccgaggctgtccgtcatactccacatgaagaatgggctcttggtaagggtcaagagaagagagccagtgatgaacacctgagaactgagaggatacatgcttattaa</cdnaseq>|
 
AA = <aaseq>REQVQTRRRRRRRQAIGRRLAFLLPLRRRDRRQRRRRRVHQGHG                    DEPPRRRPRHHELGAVVVLLPPLHEPARRAEAPAGAGAHRFPQAAAAAGAALPRQRRH                    GDVRRERGEEPPVPARGPLRGHEAVPAGAFGAQGGGRRRRAPQRARGDGRRQGAGVLL                    LHGEDEAGVGQGLQGVQAGAVDHRGRQAAVRAVEQVRRVQLRAEDMPRQGDGARADEG                    HGGGHGVELCRGGGAGARRGAEAVRHTPHEEWALGKGQEKRASDEHLRTERIHAY</aaseq>|
 
DNA = <dnaseqindica>891..1712#acacacaaaactgttgcactccactgcgctatagatagctacgtgctgcattcgcgcgcgtgtgcatgcatggcagcaattggtaacatgaatttgttcgacttgttcttcgtcttgcagcttctcctgtcaggagtatgcgtgctcgtcatctgctaccgatatcagcggcttaaatccatgaaaaaatgtagcctaggggttgtccagtggccgatcgtcggcgtgctcccggccatcgtcgccaacatgcaccgcctcctcgacggcgtgaccttcctgctggccacgtcgcagctcaacttccagtgccgcttctggctcgccggcttccggttcttcgtcacctgcgacccggacaacgtgcgccacatcttcacgtccaacttcgacaactaccccaagggcgacgtgttcgccgacatgttcgacgtcctcggcggcggcatcttcaacaccgacggcgagcggtggcggcggcagcggaacaaggcccagatgctcatgaccacgccgcggttccgcgccttcgtggcgcgctccagcctcgacaaggtggagaagggcctcctgcctttcctcgcgcacgtcgccgacgcccggaagacgtgcgacctgcaggacgtgttcacgcggtggtcgctcgacgcgacgtgccacctggtgttcggcgtcgaccccggctgcctggacatcggcctgccggaggtccccttcgcacgggcgatggacgacgtgctgcggacgatcttcctccgccacaccatgccagtgtcgttctggaagacgatgagatggctagggattgggcacgagaagaggaacgccgcggcgaggcggacggtcgagagcttcgtcgcgtcggccatcgcgaaacacagagccgatgacgagagcaagtccagacaaggcggcggcggaggcggcgacaagcaatcggtcgccgacttgctttcctccttcctctgcgacgacgagatcgccggcagcgccgacgccgacgtgtacatcagggacatggcgatgaacctcctcgtcgccggccgcgacaccacgagctcggcgctgtcgtggttcttctacctcctctccacgaacccgcgcgtcgagcagaagctcctgcaggagctggcgcccatcgcttcccgcaagccgcagctgcagcaggggcggctcttccccggcaacggcggcatggtgacgttcgacgcgagcgaggtgaggaacctcctgtacctgcacgcggccctttgcgaggccatgaggctgtacccgccggtgcctttggagcacaaggcggcggtcgccgacgacgtgctccccagcgggcacgaggtgatggccggcgacaaggtgctggtgttctactactccatggggaggatgaagcgggtgtggggcaaggactgcagggagttcaggccggagcggtggatcaccgaggacggcaagctgcggtacgtgccgtcgaacaagttcgtcgcgttcaactccgggccgaggacatgcctcggcaaggagatggcgctcgtgcagatgaaggtcacggcggcggccatggcgtggaactttgccgtggaggtggtgccggggcacgtcgtggagccgaggctgtccgtcatactccacatgaagaatgggctcttggtaagggtcaagagaagagagccagtgatgaacacctgagaactgagaggatacatgcttattaagtgtgatcaatatgctattacatgatgtacagtacagagttttaatttatgttggtgtcgagcgtggtgcttcatctgtaccgtgtgcggtacgcgatagaggcctaaatttgcacattggttgcgtcagatttgtaatggaatccctcaaggatacgaattaataacttggggggtgtgtc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001186330.1 RefSeq:Os03g0140400]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 3]]
 
[[Category:Chromosome 3]]
 

Latest revision as of 15:56, 11 October 2016

The rice Os03g0140400 was reported as CYP96B4 in 2014 [1] by researchers from China.

Annotated Information

Figure 4. Subcellular localization of pJIT163_hGFP::SD37 using ER-mCherry and Golgi-mCherry in rice protoplast cells.[1].

Gene Symbol

  • Os03g0140400 <=> CYP96B4,OsCYP96B4,SD37,OsSD37

Function

  • Slight over-expression of CYP96B4 in transgenic lines promotes plant growth, and RNA interference targeting CYP96B4 in transgenic lines mimics the mutant phenotype
  • CYP96B4 may be an important regulator of plant growth that affects plant height in rice.

Phenotypic analysis

  • The researchers identified a spontaneous rice dwarf mutant in the indica cultivar 3037 (Oryza sativa L ssp. indica cv. 3037). This mutant displayed a dwarf phenotype during all stages of development, from seedling to grain filling (Figure 1A, 1B).
  • All internodes of the sd37 mutant were shorter than those of the wild type (Figure 1C). At the heading stage, the mutant showed a 25–35% reduction in plant height compared to wild-type plants. We thus named this mutant semi-dwarf 37 (sd37). Furthermore, the sd37 mutant had smaller panicles and shorter rachises than the wild type (Figure 1D).
  • The grains of sd37 were shorter and wider than those of the wild type (Figure 1E; Table 1). Morphological measurements of the wild type and the sd37 mutant are shown in Table 1. In contrast, the root length of the mutant was equivalent to that of the wild type in young seedlings (Figure 1F).

Expression

  • CYP96B4 was predominantly expressed in the shoot apical meristem and developing leaf and root maturation zone but not in the root apical meristem.

Subcellular Localization

  • Subcellular Localization analysis of CYP96B4 showed that its protein was ER-localized protein.

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Plant Genomics, National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China
  • National Engineering Research Center for Vegetables, Beijing Academy of Agriculture and Forestry Sciences, Key Laboratory of Biology and Genetic Improvement of Horticultural Crops (North China), Beijing, China

References

  1. 1.0 1.1 Zhang J, Liu X, Li S, Cheng Z, Li C. The rice semi-dwarf mutant sd37, caused by a mutation in CYP96B4, plays an important role in the fine-tuning of plant growth. PLoS One. 2014 Feb 3;9(2):e88068. doi: 10.1371/journal.pone.0088068. eCollection 2014. PubMed PMID: 24498428


Structured Information