Difference between revisions of "Os03g0300000"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os03g0300000| Description = Similar to Xyloglucan 6-xylosyltransferase (EC 2.4.2.39) (AtXT1)| Version = NM_001056388.1 GI:115452504 GeneID:433256...")
 
(Phenotypic analysis)
 
(8 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os03g0300000''''' was reported as '''''OsXXT1''''' in 2014 <ref name="ref1" /> by researchers from China.  
GeneName = Os03g0300000|
 
Description = Similar to Xyloglucan 6-xylosyltransferase (EC 2.4.2.39) (AtXT1)|
 
Version = NM_001056388.1 GI:115452504 GeneID:4332564|
 
Length = 1244 bp|
 
Definition = Oryza sativa Japonica Group Os03g0300000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
[[File:67-Os03g0300000.png|right|thumb|327px|'''Figure 1.''' ''Phenotype of root hairs from wild type (WT, cv Kasalath), srh2, and srh2 complemented by Ubiquitin-1 promoter ::OsXXT1.t.<ref name="ref1" />.'']]
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
===Gene Symbol===
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
*'''''Os03g0300000''''' '''<=>''' '''''OsXXT1,XXT1,SRH2,OsSRH2'''''
|
+
===Function===
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
+
* '''''OsXXT1''''' in maintaining cell wall structure and tensile strength in rice, a typical grass species that contains relatively low XyG content in cell walls.
AP = Chromosome 3:10598134..10599377|
+
===Phenotypic analysis===
CDS = 10598331..10599377|
+
* Seeds from the M 2 generation of an EMS-mutagenized population of Indica cultivar Kasalath, were germinated and grown in nutrient solution to screen for mutants with abnormal root hair phenotype. Seven days after germination, a mutant with significantly reduced length in root hairs was identified (Fig. 1A, B). No obvious difference was observed in leaf or root growth between wild type and mutant (Fig. S1).
GCID = <gbrowseImage1>
+
* The mutant was designated as srh2. Scanning electron microscopy of the wild-type and srh2 root surface showed that the length of the root hairs of srh2 were shorter than those of wild type.
name=NC_008396:10598134..10599377
+
* However, no significant difference was found in root hair density or distribution pattern between srh2 and wild type (Fig. 1D, E).
source=RiceChromosome03
+
 
preset=GeneLocation
+
===Expression===
</gbrowseImage1>|
+
* '''''OsXXT1''''' and '''''OsGT2''''' have similar expression patterns and are expressed across a variety of tissues. In contrast, other members of this family (OsGT3 to OSGT5) display a more restricted expression pattern, suggesting that '''''OsXXT1''''' and '''''OsGT2''''' are the predominantly expressed genes.
GSID = <gbrowseImage2>
+
 
name=NC_008396:10598134..10599377
+
===Evolution===
source=RiceChromosome03
+
* '''''OsXXT1''''' displays more than 70% amino acid sequence identity with the previously characterized Arabidopsis thaliana XYG XYLOSYL TRANSFERASE 1 (AtXXT1) and XYG XYLOSYL TRANSFERASE 2 (AtXXT2), which catalyse the transfer of xylose onto β-1,4-glucan chains.
preset=GeneLocation
+
 
</gbrowseImage2>|
+
You can also add sub-section(s) at will.
CDNA = <cdnaseq>acgctccgggacccgccctacacgctgggccccaagatctccgactgggacgagcagcgggccgcgtggcaccgccgccacccggagacgccgcccttcgtcaacgacgtcaagccgcgggtgctgctcgtcacgggctcctcgcccaagccgtgcgagaaccccgtcggcgaccactacctcctcaagtccatcaagaacaagatggactactgccgcgtccacggcctcgagatcttctacaacatggcgctgctcgacgccgagatggccggattctgggccaagctcccgctcctccgcgcgctgctcctcgcgcacccggagatcgagttcctctggtggatggactccgacgccatgttctccgacatggcattcgagctgccatgggagcggtacggcccctacaacctcatcatgcacggctgggatgagatggtctacgacgacaagaactggattggcctcaacacaggcagcttcttgctgcgcaactgccaatggtcgcttgatttccttgatacatgggcaccaatgggaccaaagggccctgtccgtattgaggccgggaaggttttgaccaagtacttgaaggatcggccggtgtttgaggctgatgatcagtcggccatggtatacatccttgctacagagcgtgagaaatggggtgacaaggtgtaccttgagaatgggtattacctccatggatattggggtatcttggttgataggtatgaggaaatgcttgagaattaccatccaggacttggtgatcaccggtggccactggtcactcactttgtcggatgcaagccgtgtgggaagtttggggattaccctgtggagaggtgcctcaagcagatggagcgtgctttcaattttggggataatcagatcttgcaaatgtatgggtttacacacaagtcgcttggcagcaggaaggtgaagaggatcaggaatgagactagcaacccacttgatgtcaaggatgaactagggttgctccacccagcattcaaggccatgaagactacttctacgtga</cdnaseq>|
+
 
AA = <aaseq>TLRDPPYTLGPKISDWDEQRAAWHRRHPETPPFVNDVKPRVLLV                    TGSSPKPCENPVGDHYLLKSIKNKMDYCRVHGLEIFYNMALLDAEMAGFWAKLPLLRA                    LLLAHPEIEFLWWMDSDAMFSDMAFELPWERYGPYNLIMHGWDEMVYDDKNWIGLNTG                    SFLLRNCQWSLDFLDTWAPMGPKGPVRIEAGKVLTKYLKDRPVFEADDQSAMVYILAT                    EREKWGDKVYLENGYYLHGYWGILVDRYEEMLENYHPGLGDHRWPLVTHFVGCKPCGK                    FGDYPVERCLKQMERAFNFGDNQILQMYGFTHKSLGSRKVKRIRNETSNPLDVKDELG                    LLHPAFKAMKTTST</aaseq>|
+
==Labs working on this gene==
DNA = <dnaseqindica>1..1047#acgctccgggacccgccctacacgctgggccccaagatctccgactgggacgagcagcgggccgcgtggcaccgccgccacccggagacgccgcccttcgtcaacgacgtcaagccgcgggtgctgctcgtcacgggctcctcgcccaagccgtgcgagaaccccgtcggcgaccactacctcctcaagtccatcaagaacaagatggactactgccgcgtccacggcctcgagatcttctacaacatggcgctgctcgacgccgagatggccggattctgggccaagctcccgctcctccgcgcgctgctcctcgcgcacccggagatcgagttcctctggtggatggactccgacgccatgttctccgacatggcattcgagctgccatgggagcggtacggcccctacaacctcatcatgcacggctgggatgagatggtctacgacgacaagaactggattggcctcaacacaggcagcttcttgctgcgcaactgccaatggtcgcttgatttccttgatacatgggcaccaatgggaccaaagggccctgtccgtattgaggccgggaaggttttgaccaagtacttgaaggatcggccggtgtttgaggctgatgatcagtcggccatggtatacatccttgctacagagcgtgagaaatggggtgacaaggtgtaccttgagaatgggtattacctccatggatattggggtatcttggttgataggtatgaggaaatgcttgagaattaccatccaggacttggtgatcaccggtggccactggtcactcactttgtcggatgcaagccgtgtgggaagtttggggattaccctgtggagaggtgcctcaagcagatggagcgtgctttcaattttggggataatcagatcttgcaaatgtatgggtttacacacaagtcgcttggcagcaggaaggtgaagaggatcaggaatgagactagcaacccacttgatgtcaaggatgaactagggttgctccacccagcattcaaggccatgaagactacttctacgtgataagtgataattagagtacaatgccacgcgttatttcgttcattgtagatccttttgggtctaaaatcttaaaaaggtgttctttttgtagacttgggttgacaagggagtttgggttgggatcaaacatcaaaggatggatatctatgttgtaatgtgaaattttaggagaacaatggtatgtttattgctggcat</dnaseqindica>|
+
* State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, 388 Yuhangtang Road, Hangzhou, 310058, P. R. China
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056388.1 RefSeq:Os03g0300000]|
+
* University of Western Australia-Zhejiang University Joint Research Laboratory in Genomics and Nutriomics, College of Life Sciences, Zhejiang University, 388 Yuhangtang Road, Hangzhou, 310058, P. R. China
}}
+
* ARC Centre of Excellence in Plant Energy Biology, The University of Western Australia, 35 Stirling Highway, Crawley, 6009 Western Australia, Australia
[[Category:Genes]]
+
* State Key Laboratory of Plant Genomics, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China
[[Category:Japonica mRNA]]
+
* Department of Botany, School of Life Science, Australian Research Council Centre of Excellence in Plant Energy Biology, La Trobe
[[Category:Oryza Sativa Japonica Group]]
+
University, Bundara, Victoria 3086, Australia
[[Category:Japonica Genes]]
+
 
[[Category:Japonica Chromosome 3]]
+
==References==
[[Category:Chromosome 3]]
+
<references>
 +
* <ref name="ref1">
 +
Wang C, Li S, Ng S, Zhang B, Zhou Y, Whelan J, Wu P, Shou H. Mutation in
 +
xyloglucan 6-xylosytransferase results in abnormal root hair development in Oryza
 +
sativa. J Exp Bot. 2014 Aug;65(15):4149-57. doi: 10.1093/jxb/eru189. Epub 2014
 +
May 15. PubMed PMID: 24834920; PubMed Central PMCID: PMC4112626.
 +
</ref>
 +
 
 +
</references>
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 3]]

Latest revision as of 06:52, 15 October 2016

The rice Os03g0300000 was reported as OsXXT1 in 2014 [1] by researchers from China.

Annotated Information

Figure 1. Phenotype of root hairs from wild type (WT, cv Kasalath), srh2, and srh2 complemented by Ubiquitin-1 promoter ::OsXXT1.t.[1].

Gene Symbol

  • Os03g0300000 <=> OsXXT1,XXT1,SRH2,OsSRH2

Function

  • OsXXT1 in maintaining cell wall structure and tensile strength in rice, a typical grass species that contains relatively low XyG content in cell walls.

Phenotypic analysis

  • Seeds from the M 2 generation of an EMS-mutagenized population of Indica cultivar Kasalath, were germinated and grown in nutrient solution to screen for mutants with abnormal root hair phenotype. Seven days after germination, a mutant with significantly reduced length in root hairs was identified (Fig. 1A, B). No obvious difference was observed in leaf or root growth between wild type and mutant (Fig. S1).
  • The mutant was designated as srh2. Scanning electron microscopy of the wild-type and srh2 root surface showed that the length of the root hairs of srh2 were shorter than those of wild type.
  • However, no significant difference was found in root hair density or distribution pattern between srh2 and wild type (Fig. 1D, E).

Expression

  • OsXXT1 and OsGT2 have similar expression patterns and are expressed across a variety of tissues. In contrast, other members of this family (OsGT3 to OSGT5) display a more restricted expression pattern, suggesting that OsXXT1 and OsGT2 are the predominantly expressed genes.

Evolution

  • OsXXT1 displays more than 70% amino acid sequence identity with the previously characterized Arabidopsis thaliana XYG XYLOSYL TRANSFERASE 1 (AtXXT1) and XYG XYLOSYL TRANSFERASE 2 (AtXXT2), which catalyse the transfer of xylose onto β-1,4-glucan chains.

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, 388 Yuhangtang Road, Hangzhou, 310058, P. R. China
  • University of Western Australia-Zhejiang University Joint Research Laboratory in Genomics and Nutriomics, College of Life Sciences, Zhejiang University, 388 Yuhangtang Road, Hangzhou, 310058, P. R. China
  • ARC Centre of Excellence in Plant Energy Biology, The University of Western Australia, 35 Stirling Highway, Crawley, 6009 Western Australia, Australia
  • State Key Laboratory of Plant Genomics, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China
  • Department of Botany, School of Life Science, Australian Research Council Centre of Excellence in Plant Energy Biology, La Trobe

University, Bundara, Victoria 3086, Australia

References

  1. 1.0 1.1 Wang C, Li S, Ng S, Zhang B, Zhou Y, Whelan J, Wu P, Shou H. Mutation in xyloglucan 6-xylosytransferase results in abnormal root hair development in Oryza sativa. J Exp Bot. 2014 Aug;65(15):4149-57. doi: 10.1093/jxb/eru189. Epub 2014 May 15. PubMed PMID: 24834920; PubMed Central PMCID: PMC4112626.

Structured Information