Difference between revisions of "Os05g0597100"

From RiceWiki
Jump to: navigation, search
(Expression)
(Evolution)
 
(5 intermediate revisions by 3 users not shown)
Line 1: Line 1:
OsHDT1(Os05g0597100),is a histone deacetylase gene, that is involed in flowering time control and innate immunity in rice.
+
The rice '''''Os05g0597100''''' was reported as '''''HDT701''''' in 2012 <ref name="ref1" /> by researchers from USA and China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os05g0597100''''' '''''<=>''''' '''''HDT701,OsHDT1 '''''
 +
 
===Function===
 
===Function===
OsHDT1 function in histone deacetylation[1]:
+
* '''''HDT701''''' is a member of the plant-specific HD2 subfamily of HDACsencodes which a Histone H4 Deacetylase.
OsHDT1 may be involved in histone deacetylation on a subset of genes, as over-expression of OsHDT1 led to decreases of histone acetylation on flowering repressor genes in both parent and hybrid backgrounds. Increased OsHDT1 promoted deacetylation that correlated with the repression of OsGI and Hd1 and early flowering in the hybrid. The effect of OsHDT1 seemed to occur at a higher acetylation phase of target genes, suggesting that OsHDT1 might be involved in circadian oscillation of histone acetylation and gene expression.
+
* '''''HDT701''''' negatively regulates innate immunity by modulating the levels of histone H4 acetylation of PRR and defense-related genes in rice.
 
 
OsHDT1 function as a trans-acting regulator of hybrid differential gene expression[1]:
 
The nonadditive up-regulation (or overdominance) of OsGI and Hd1 observed in the hybrid likely contributed to the below mid-parent expression of Ehd1, RFT1 and Hd3a under long day conditions. Reduction of the nonadditive increase of Hd1 and OsGI by OsHDT1 over-expression and the early flowering phenotype indicates that the “late flowering overdominance” in SY63 can be suppressed by elevated OsHDT1. These observations together with the effects of altered OsHDT1 expression on other nonadditive genes provide direct evidence of regulation of nonadditive or differential gene expression in hybrid by a trans-acting factor.
 
 
 
OsHDT1 level was important for a subset of differentially expressed genes including flowering time genes in the hybrid, suggesting that OsHDT1 may have a function in parental genome interaction for gene expression in the hybrid[1].
 
 
 
The histone deacetylase gene OsHDT1 is associated with enhanced utilization of heterosis in rice [2].
 
  
 
===Expression===
 
===Expression===
OsHDT1 expression displays a circadian rhythm: OsHDT1 expression exhibited also a circadian oscillation and was sensitive to photoperiods[1].
+
* Transcription of '''''HDT701''''' is increased in the compatible reaction and decreased in the incompatible reaction after infection by the fungal pathogen Magnaporthe oryzae.
 
+
* '''''HDT701''''' can bind to defense-related genes to regulate their expression.
OsHDT1 over-expression affects the flowering time of hybrid rice[1];
 
increased OsHDT1 level may alter flowering time-related gene expression in the hybrid, while without a clear effect in the parent background.
 
 
 
OsHDT1 over-expression suppresses overdominance expression of flowering time genes in hybrid rice[1];
 
increased OsHDT1 expression suppressed the overdominance expression of OsGI and Hd1 in the hybrid under long day conditions, which led to early flowering.
 
 
 
Impact of altered OsHDT1 levels on gene expression in rice hybrid[1];
 
OsHDT1 over-expression had a negative impact on histone H4 acetylation on these genes in both parent and hybrid backgrounds.
 
 
 
Over-expression of OsHDAC1 (HDA702) led to increased growth rate and altered architecture in transgenic rice[3].
 
 
 
OsHDAC1 could epigenetically repress the OsNAC6 gene that controls rice seedling root growth[4].
 
 
 
OsHDAC1 binds to the OsNAC6 promoter and deacetylates histones H3 and H4. Down-regulation of a Sir2-type HDAC gene, SRT701 (OsSRT1), induced H2O2 production, DNA fragmentation, cell death and lesions mimicking plant hypersensitive responses induced by pathogen attacks, whereas over-expression of the gene enhanced the tolerance to oxidative stress[5].
 
 
 
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* Overexpression of '''''HDT701''''' in transgenic rice leads to decreased levels of histone H4 acetylation and enhanced susceptibility to the rice pathogens M. oryzae and Xanthomonas oryzae pv oryzae (Xoo).  
 
+
* By contrast, silencing of '''''HDT701''''' in transgenic rice causes elevated levels of histone H4 acetylation and elevated transcription of pattern recognition receptor (PRR) and defense-related genes, increased generation of reactive oxygen species after pathogen-associated molecular pattern elicitor treatment, as well as enhanced resistance to both M. oryzae and Xoo.
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Department of Plant Pathology, Ohio State University, Columbus, Ohio 43210
 
+
* State Laboratory for Biology of Plant Diseases and Insect Pests, Institute of Plant Protection, Chinese Academy of Agricultural Sciences, Beijing 100193, China
 +
* Department of Plant and Soil Sciences, Delaware Biotechnology Institute, University of Delaware, Newark, Delaware 19711
 
==References==
 
==References==
 
+
<references>
[1] Li C, Huang L, Xu C, Zhao Y, Zhou DX (2011) Altered levels of histone deacetylase OsHDT1 affect differential gene expression patterns in hybrid rice. PLoS ONE 6:e21789.
+
* <ref name="ref1">
[2] Zhou Daoxiu, Li Chen, Huang Limin, Use of a Histone Deacetylase Gene OsHDT1 in Enhancing Rice Heterosis. GEN, 2010.
+
Ding B, Bellizzi Mdel R, Ning Y, Meyers BC, Wang GL. HDT701, a histone H4
[3] Jang et al., 2003 I.C. Jang, Y.M. Pahk, S.I. Song, H.J. Kwon, B.H. Nahm, J.K. Kim
+
deacetylase, negatively regulates plant innate immunity by modulating histone H4
Structure and expression of the rice class-I type histone deacetylase genes OsHDAC1-3: OsHDAC1 overexpression in transgenic plants leads to increased growth rate and altered architecture.Plant J., 33 (2003), pp. 531–541.
+
acetylation of defense-related genes in rice. Plant Cell. 2012 Sep;24(9):3783-94.
[4]Chung et al., 2009 P.J. Chung, Y.S. Kim, J.S. Jeong, S.H. Park, B.H. Nahm, J.K. Kim
+
doi: 10.1105/tpc.112.101972. Epub 2012 Sep 11. PubMed PMID: 22968716; PubMed
The histone deacetylase OsHDAC1 epigenetically regulates the OsNAC6 gene that controls seedling root growth in rice
+
Central PMCID: PMC3480302.
Plant J., 59 (2009), pp. 764–776.
+
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os05g0597100|
 
Description = Similar to Nucleolar histone deacetylase HD2-p39|
 
Version = NM_001063058.1 GI:115465846 GeneID:4339823|
 
Length = 2800 bp|
 
Definition = Oryza sativa Japonica Group Os05g0597100, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
 
AP = Chromosome 5:29835095..29837894|
 
CDS = 29835401..29835461,29835543..29835675,29835762..29835858,29835978..29836046,29836126..29836283<br>,29836388..29836432,29836503..29836530,29836661..29836879,29836980..29837050<br>,29837799..29837811|
 
GCID = <gbrowseImage1>
 
name=NC_008398:29835095..29837894
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008398:29835095..29837894
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggagttctggggtcttgaagtcaagcctggacagactgtcaaatgtgagcctgaagatgaacgctttttgcacctttctcaggctgctcttggggaatcaaagaaaggatctgacaatgcagtaatgtatgttaaaactgatgatcaaaagctagtcattggaaccctctcagctgacaagttccctcaaatccagtttgatttggtctttgacaaagagtttgagctgtcacacacttcaaagactgctagtgtgttcttttctggctacaaagtttcccagccggctgaggaagatgaaatggattttgattctgaagaagttgaagatgaagaggaggaagaaaagatcattccagctcccagggcaaatggcaaagttgaagggaaggaaaatgagcagaaaaaacaaggcaagacagattcttcagcttcaaaatcaaaggctgcagtgaatgacgatgatgatgatgatgacagtgatgaggatgattctgaggacgaagatctttctcctgaggatgatgatgatgattcttctgaggatgattccagcgaagatgatgaggatgagagtgacgaggaagatactcccaagaagccagagactggaaagaggaaagtagctgaaattgtgttgaagacaccttcgtctgataagaaagcaaagattgctacaccgtcaggccagaagacaggtgacaagaagggtgtccatgtagcaactccacatccggcaaagcaggctagcaagacccccgtgaatgacaagtcaaaggagaagtccccaaaatccggtggtgggtcaatttcttgcaagtcatgcagcaagacgttcaacagtgaaatggctctgcaatctcactcgaaggccaagcaccccgccaagtga</cdnaseq>|
 
AA = <aaseq>MEFWGLEVKPGQTVKCEPEDERFLHLSQAALGESKKGSDNAVMY                    VKTDDQKLVIGTLSADKFPQIQFDLVFDKEFELSHTSKTASVFFSGYKVSQPAEEDEM                    DFDSEEVEDEEEEEKIIPAPRANGKVEGKENEQKKQGKTDSSASKSKAAVNDDDDDDD                    SDEDDSEDEDLSPEDDDDDSSEDDSSEDDEDESDEEDTPKKPETGKRKVAEIVLKTPS                    SDKKAKIATPSGQKTGDKKGVHVATPHPAKQASKTPVNDKSKEKSPKSGGGSISCKSC                    SKTFNSEMALQSHSKAKHPAK</aaseq>|
 
DNA = <dnaseqindica>2434..2494#2220..2352#2037..2133#1849..1917#1612..1769#1463..1507#1365..1392#1016..1234#845..915#84..96#agccttaaaccctagctccgcctcccacctcccttttcttttctagggttcttccgccgccgccgccgccgccgccgattccgatggagttctggggtaatctcctcctctacctctctctcttcccctccctctctccatccatctatattgcgcagtttcggtttttgtttgatttgatttggacgcgattcgtttgatacggtgtttggttcgtgcgcttctcttcgttacggattagacgcgattcgtttcaccatcgagtgttttgggttcgcgcggaatcgcggccatggctcttccctgtcttcgttagggattaattagggattttagttttcatgggccgcgactatttccatcatacatgcgtaaccgcattggttgccgcctttatgtttgcgagaatcatcattttgttcattctgtttctgtttcagttaacacattctgattatcttcagtctcatagttgttatcatatattactacagtacttaccttgcttcggccccatcgtttggcatatttacgaacgaaaaataatttgtgaataaaacttagcgatctaaaagaaaaggctgaaaaataaacttctgaaaacctccaaaatcaactccaaatttaagattgaaaattcaaattttggctgataagcataagcggaaagataaggtcgcttgtttctatgggccatcctcgttaatttactatgctagttgcttttcaactttactagctaaaggcaaatatgaactgtagtatactgtttcattcatgccttcttggaagggaaggactactctatacatgtgtttttcgctgattagtcaaagttgtgcaggtcttgaagtcaagcctggacagactgtcaaatgtgagcctgaagatgaacgctttttgcacctttctcaggtttattatgttcctcttctgtcctcctttttttgaacagtgaggcttttgtgttctcattgtgtacttaatcttttgttattcaacaattgcttggtaggctgctcttggggaatcaaagaaaggatctgacaatgcagtaatgtatgttaaaactgatgatcaaaagctagtcattggaaccctctcagctgacaagttccctcaaatccagtttgatttggtctttgacaaagagtttgagctgtcacacacttcaaagactgctagtgtgttcttttctggctacaaagtttcccagccggctgaggaagatgaatatcctttgtaatgttttaccatgtttggtcaatatatgtaatgcatataatgtcatactctattttattttcattaaggtatgtattacaatattgttttccttgacctgccttttttgttgttccacaatggattttgattctgaagaagttgaaggtatgattgctactagtgcttgtgttctgcctagagagaatttaacgagcctgtttataatttatttcagatgaagaggaggaagaaaagatcattccagctcccagggcaaatggtaccatagtttctcctttctgattatgattggaatcacagaatccttttgcacctctctttaaaactttataaggaagtacttatgactaaaacttttctaaggcaaagttgaagggaaggaaaatgagcagaaaaaacaaggcaagacagattcttcagcttcaaaatcaaaggctgcagtgaatgacgatgatgatgatgatgacagtgatgaggatgattctgaggacgaagatctttctcctgaggatgatgatgatgtgagtaatttatgggtactgttgtgtattattgtggaggattgttccatactaacagtggtgcaatggcctgttataggattcttctgaggatgattccagcgaagatgatgaggatgagagtgacgaggaagatactcccaagaaggtatgtgtatgtgtttgaaggatatagtctgcttgtttctgtgcacttatatgtgtttgaaggatacagttagtttgtttgttctgtactcttaccataaacaatgtgatgacttgcagccagagactggaaagaggaaagtagctgaaattgtgttgaagacaccttcgtctgataagaaagcaaagattgctacaccgtcaggccagaagacaggttagtagctgtgaagctgcgcctgcgatgaataaattggcactggaagtagtgatgaatttgtatcatttggtcctcctgagcaggtgacaagaagggtgtccatgtagcaactccacatccggcaaagcaggctagcaagacccccgtgaatgacaagtcaaaggagaagtccccaaaatccggtggtgggtcaatttcttgcaagtcatgcagcaagtaagtttagatgcgctgtcttcttgttttggagtattacgtaaggaaatgattcaaagtttgcatgaatgcattgtttaggacgttcaacagtgaaatggctctgcaatctcactcgaaggccaagcaccccgccaagtgaagaatgagacaacggatgctgagctgagaaatattggtgtcgtttgagttggttatctgaaatgaaatgaaatgctgcaaactatttggtgttatgagtagtgtcgtgacggtttatgtggtgcaaactatttagtctagaaaaaaaaaatctgtggtgcgaactgagctacaattttattcggtcaaggtcagtggagtgattggtttattttggatggaattattgttcttccctgttattcggttaattcccacgagaaaggattgataacaccacactgaattgactagctgaacaaagtcg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063058.1 RefSeq:Os05g0597100]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 04:07, 22 October 2016

The rice Os05g0597100 was reported as HDT701 in 2012 [1] by researchers from USA and China.

Annotated Information

Gene Symbol

  • Os05g0597100 <=> HDT701,OsHDT1

Function

  • HDT701 is a member of the plant-specific HD2 subfamily of HDACsencodes which a Histone H4 Deacetylase.
  • HDT701 negatively regulates innate immunity by modulating the levels of histone H4 acetylation of PRR and defense-related genes in rice.

Expression

  • Transcription of HDT701 is increased in the compatible reaction and decreased in the incompatible reaction after infection by the fungal pathogen Magnaporthe oryzae.
  • HDT701 can bind to defense-related genes to regulate their expression.

Evolution

  • Overexpression of HDT701 in transgenic rice leads to decreased levels of histone H4 acetylation and enhanced susceptibility to the rice pathogens M. oryzae and Xanthomonas oryzae pv oryzae (Xoo).
  • By contrast, silencing of HDT701 in transgenic rice causes elevated levels of histone H4 acetylation and elevated transcription of pattern recognition receptor (PRR) and defense-related genes, increased generation of reactive oxygen species after pathogen-associated molecular pattern elicitor treatment, as well as enhanced resistance to both M. oryzae and Xoo.

Labs working on this gene

  • Department of Plant Pathology, Ohio State University, Columbus, Ohio 43210
  • State Laboratory for Biology of Plant Diseases and Insect Pests, Institute of Plant Protection, Chinese Academy of Agricultural Sciences, Beijing 100193, China
  • Department of Plant and Soil Sciences, Delaware Biotechnology Institute, University of Delaware, Newark, Delaware 19711

References

  1. Ding B, Bellizzi Mdel R, Ning Y, Meyers BC, Wang GL. HDT701, a histone H4 deacetylase, negatively regulates plant innate immunity by modulating histone H4 acetylation of defense-related genes in rice. Plant Cell. 2012 Sep;24(9):3783-94. doi: 10.1105/tpc.112.101972. Epub 2012 Sep 11. PubMed PMID: 22968716; PubMed Central PMCID: PMC3480302.

Structured Information