Difference between revisions of "Os12g0132400"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os12g0132400| Description = Similar to Grwd-pending-prov protein| Version = NM_001072613.1 GI:115487187 GeneID:4351421| Length = 1535 bp| Defin...")
 
 
(4 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice gene Os12g0132400 was reported as '''''RIP1''''' in 20<ref name="ref1" /> by researchers from Korea.
GeneName = Os12g0132400|
 
Description = Similar to Grwd-pending-prov protein|
 
Version = NM_001072613.1 GI:115487187 GeneID:4351421|
 
Length = 1535 bp|
 
Definition = Oryza sativa Japonica Group Os12g0132400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Gene Symbol===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
*'''''Os12g0132400 <=> OsWD40-193, RIP1
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
 
|
+
===Function===
Chromosome = [[:category:Japonica Chromosome 12|Chromosome 12]]|
+
* '''''RIP1''''' is necessary for pollen maturation and germination.
AP = Chromosome 12:1561208..1562742|
+
* '''''RIP1''''' gene encodes a protein that shares significant homology with a group of proteins containing five WD40 repeat sequences.
CDS = 1561437..1561568,1561741..1561858,1561981..1562093,1562586..1562684|
+
* RIP1 is probably a nuclear protein that may form a functional complex with other proteins and carry out essential cellular and developmental roles during the late stage of pollen formation.
GCID = <gbrowseImage1>
+
===Mutation===
name=NC_008405:1561208..1562742
+
* Microscopic analysis demonstrated that development in the '''''rip1''''' pollen was delayed, starting at the early vacuolated stage. Close examination of that pollen by transmission electron microscopy also showed delayed formation of starch granules and the intine layer.
source=RiceChromosome12
+
 
preset=GeneLocation
+
* In addition, development of the mitochondria, Golgi apparatus, lipid bodies, plastids and endoplasmic reticulum was deferred in the mutant pollen.
</gbrowseImage1>|
+
 
GSID = <gbrowseImage2>
+
* Under in vitro conditions, germination of this mutant pollen did not occur, whereas the rate for wildtype pollen was 490%.
name=NC_008405:1561208..1562742
+
===Expression ===
source=RiceChromosome12
+
* Semi-quantitative reverse transcription–PCR (RT–PCR) analyses confirmed that the '''''RIP1''''' transcript was abundant at the late stages of pollen development.
preset=GeneLocation
+
 
</gbrowseImage2>|
+
===Sublocalization===
CDNA = <cdnaseq>atgaatatacggactaccattaccaggctcgctagctgtatgatagcttcaggatgcgatgatggaagtttctcaattcgtgatcttagattaatcaaggatgactccttggtcgcccattttgaataccacaagcacccgattacatctgtggaatggagcccacatgaaccgtcaacactagctgtatcatcagctgaccatcaactgacaatttgggatctttcattggaaaaagatgctgaagaggaggcagagttcagggcaaggatgagagaacaggctgatgcccctgaagatttacccccacaacttctctttgttcatcagggccagaaagacttgaaagaattgcactggcatccacagatacctagtatgatcatatctacggcagctgatggattcaatatgttgatgcccagcaacatcgatacaaccattcgagaagctgacgcatag</cdnaseq>|
+
* The green fluorescent protein (GFP)–RIP1 fusion protein is localized to the nucleus.
AA = <aaseq>MNIRTTITRLASCMIASGCDDGSFSIRDLRLIKDDSLVAHFEYH                    KHPITSVEWSPHEPSTLAVSSADHQLTIWDLSLEKDAEEEAEFRARMREQADAPEDLP                    PQLLFVHQGQKDLKELHWHPQIPSMIISTAADGFNMLMPSNIDTTIREADA</aaseq>|
+
 
DNA = <dnaseqindica>1175..1306#885..1002#650..762#59..157#gtatgatatgttcacttgaaaattcgattatcttcataaaaaattcttctaatatttcatgaatatacggactaccattaccaggctcgctagctgtatgatagcttcaggatgcgatgatggaagtttctcaattcgtgatcttagattaatcaaggtacttcatattgttaagccacactgttctgtgcttgtcagttgcaaatagcacactgaaatggcatattccctccattgctgtttttatggtttattttcagtttggatttctgtctatgcatttaatattttggaaggaaaatgtggggtattgggtcttttgatagtaatattgatacaagatgattgaaccatttcatggatgaatgatattttgcattttcttgctactagatttgtcaagccagagacgctatggtagataatttgttgcttctgatgtctatatttaatatgcagactcctgtagaatacacgctcttgtgcaaaaatcagtgcagctagatagttaaacgataatgttaattctttgttatttgaacaccttttacaactataataatttcttctgttcatatagtctcatcttgctgttgaacgacggtattcacatcaaaatcatatcttttgttttattttctacttctaggatgactccttggtcgcccattttgaataccacaagcacccgattacatctgtggaatggagcccacatgaaccgtcaacactagctgtatcatcagctgaccatcaactgacgtaagtctcctcactccaagttttataccttatgtttaaagtgtgctgaaatgccccaaaaagaatgctttctttactattttctgacttgcatttttcaatcctgaattgtttgtgtacagaatttgggatctttcattggaaaaagatgctgaagaggaggcagagttcagggcaaggatgagagaacaggctgatgcccctgaagatttacccccacaacttctctttgttcatcaggtactgttaccacacttgttttatgtttacttcctctcattttcatatcattgtgttcaccattccttgtgtaattaaaatacatgtttgtggacctcgagatgtatttcaaaagtacagacactgttactgagtgaaatcataaatgtgatgttgattgttttatgtgcagggccagaaagacttgaaagaattgcactggcatccacagatacctagtatgatcatatctacggcagctgatggattcaatatgttgatgcccagcaacatcgatacaaccattcgagaagctgacgcatagatttctacagtagttgtttatctgaatcaaggtttcatgggttttttttttttttgaagtggatgagtgtaatgatactgcatgtctacaagtatcagtttttgatagcttgtatcctagtttcgttgtcattcatagtggtaggttctcagttttgcactgatgtcgcccgaatgaggataatcaaaagtatctcgatcaactgaaatgacatgttatattctacaag</dnaseqindica>|
+
You can also add sub-section(s) at will.
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072613.1 RefSeq:Os12g0132400]|
+
==Labs working on this gene==
}}
+
* National Research Laboratory of Plant Functional Genomics, Division of Molecular and Life Sciences, Republic of Korea
[[Category:Genes]]
+
* Functional Genomic Center, Pohang University of Science and Technology, Pohang 790-784, Republic of Korea
[[Category:Japonica mRNA]]
+
* Yeongnam Agricultural Research Institute, National Institute of Crop Science, Rural Development Administration, Milyang, 627-130,
[[Category:Oryza Sativa Japonica Group]]
+
Republic of Korea
[[Category:Japonica Genes]]
+
==References==
[[Category:Japonica Chromosome 12]]
+
<references>
[[Category:Chromosome 12]]
+
* <ref name="ref1">
 +
Han MJ, Jung KH, Yi G, Lee DY, An G. Rice Immature Pollen 1 (RIP1) is a
 +
regulator of late pollen development. Plant Cell Physiol. 2006
 +
Nov;47(11):1457-72. Erratum in: Plant Cell Physiol. 2007 Jan;48(1):204. PubMed
 +
PMID: 16990291.
 +
 
 +
</ref>
 +
</references>
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 12]]

Latest revision as of 07:26, 20 December 2016

The rice gene Os12g0132400 was reported as RIP1 in 20[1] by researchers from Korea.

Annotated Information

Gene Symbol

  • Os12g0132400 <=> OsWD40-193, RIP1

Function

  • RIP1 is necessary for pollen maturation and germination.
  • RIP1 gene encodes a protein that shares significant homology with a group of proteins containing five WD40 repeat sequences.
  • RIP1 is probably a nuclear protein that may form a functional complex with other proteins and carry out essential cellular and developmental roles during the late stage of pollen formation.

Mutation

  • Microscopic analysis demonstrated that development in the rip1 pollen was delayed, starting at the early vacuolated stage. Close examination of that pollen by transmission electron microscopy also showed delayed formation of starch granules and the intine layer.
  • In addition, development of the mitochondria, Golgi apparatus, lipid bodies, plastids and endoplasmic reticulum was deferred in the mutant pollen.
  • Under in vitro conditions, germination of this mutant pollen did not occur, whereas the rate for wildtype pollen was 490%.

Expression

  • Semi-quantitative reverse transcription–PCR (RT–PCR) analyses confirmed that the RIP1 transcript was abundant at the late stages of pollen development.

Sublocalization

  • The green fluorescent protein (GFP)–RIP1 fusion protein is localized to the nucleus.

You can also add sub-section(s) at will.

Labs working on this gene

  • National Research Laboratory of Plant Functional Genomics, Division of Molecular and Life Sciences, Republic of Korea
  • Functional Genomic Center, Pohang University of Science and Technology, Pohang 790-784, Republic of Korea
  • Yeongnam Agricultural Research Institute, National Institute of Crop Science, Rural Development Administration, Milyang, 627-130,

Republic of Korea

References

  1. Han MJ, Jung KH, Yi G, Lee DY, An G. Rice Immature Pollen 1 (RIP1) is a regulator of late pollen development. Plant Cell Physiol. 2006 Nov;47(11):1457-72. Erratum in: Plant Cell Physiol. 2007 Jan;48(1):204. PubMed PMID: 16990291.

Structured Information