|
|
| (2 intermediate revisions by 2 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os01g0853400''''' was reported as '''''COI1''''' in 2012 <ref name="ref1" /> by researchers from China. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os01g0853400''''' '''<=>''' '''''COI1,OsCOI1a,OsCOI1,Os_F0728''''' |
| | + | |
| | ===Function=== | | ===Function=== |
| − | The F-box protein coronatine insensitive 1 (COI1),(The rice genome contains two closely related COI1genes, OsCOI1a(Os01g0853400) and OsCOI1b(Os05g0449500), which share 83% and 82% sequence identity at the DNA and protein levels, respectively.) a component of the SCF E3 ubiquitin ligase, has been identified as a principal component of a receptor of JA in Arabidopsisand other plants, and the JA ZIM domain (JAZ) family proteins are key regulators of JA signaling that repress transcription of JA-responsive genes through interaction with transcription factors, such as MYC2 . This transcriptional repression requires novel interactor of JAZ (NINJA) and TOPLESS corepressor proteins. Bioactive JA, the jasmonoyl-isoleucine conjugate, promotes physical interaction between COI1 and JAZ proteins that results in degradation of JAZs by the 26S proteasome, leading to initiation of JA responses. Therefore, the SCF COI1 –JAZ protein complex acts as a core site of JA perception. As a regulatory loop, JA also activates JAZ gene transcription, leading to thedown-regulation of JA action and the dynamic nature of JA response. | + | * The jasmonic acid (JA) pathway plays a key role in plant defense responses against herbivorous insects. |
| | + | * CORONATINE INSENSITIVE1 ('''''COI1''''') is an F-box protein essential for all jasmonate responses. |
| | + | * '''''OsCOI1''''' is an indispensable signaling component, controlling JA-regulated defense against chewing insect (LF) in rice plants, and COI1 is also required for induction of TrypPI, POD and PPO in rice defense response to LF infestation. |
| | + | |
| | + | ===Phenotypic analysis=== |
| | + | * The researchers silenced OsCOI1 in rice plants via RNA interference (RNAi) to determine the role of OsCOI1 in rice defense against rice leaf folder (LF) Cnaphalocrocis medinalis, a chewing insect, and brown planthopper (BPH) Nilaparvata lugens, a phloem-feeding insect. |
| | + | * In wild-type rice plants (WT), the transcripts of OsCOI1 were strongly and continuously up-regulated by LF infestation and methyl jasmonate (MeJA) treatment, but not by BPH infestation. |
| | + | * The abundance of trypsin protease inhibitor (TrypPI), and the enzymatic activities of polyphenol oxidase (PPO) and peroxidase (POD) were enhanced in response to both LF and BPH infestation, but the activity of lipoxygenase (LOX) was only induced by LF. |
| | + | * The RNAi lines with repressed expression of OsCOI1 showed reduced resistance against LF, but no change against BPH. |
| | + | * Silencing OsCOI1 did not alter LF-induced LOX activity and JA content, but it led to a reduction in the TrypPI content, POD and PPO activity by 62.3%, 48.5% and 27.2%, respectively. |
| | + | * In addition, MeJA- induced TrypPI and POD activity were reduced by 57.2% and 48.2% in OsCOI1 RNAi plants. |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | The transcript levels of both OsCOI1a and OsCOI1bwere significantly reduced in these RNAi lines as detected by RNA blot and quantitative RT-PCR (qRT-PCR) | + | * The transcripts of '''''OsCOI1''''' were strongly and continuously up-regulated by LF infestation and methyl jasmonate (MeJA) treatment, but not by BPH infestation. |
| − | analyses (Fig. 1 A and B), indicating that OsCOI1 expression was effectively knocked down by RNAi.
| |
| − | | |
| − | [[File:1.png]]
| |
| − | | |
| − | | |
| − | (A) Suppression of OsCOI1a expression in transgenic RNAi lines as shown by RNA blot analysis. A fragment of 825 to 1,244 nt ofOsCOI1 was used as the probe, and 25SrRNAwas used as the loading control.
| |
| − | | |
| − | | |
| − | [[File:2.jpg]]
| |
| − | | |
| − | | |
| − | (B) Suppression ofOsCOI1b expression in transgenic RNAi lines as shown by qRTPCR.
| |
| − | | |
| − | | |
| − | 2.Elongation of OsCOI1-RNAi Plants Is Inhibited by Attenuating GA Signaling.
| |
| − | EUI1 overexpression resulted in a series of GA-deficient phenotypes, with drastic reduction of the bioactive GAs and accumulation or stabilization of the DELLA protein SLR1 .We crossed the EUI1-overexpression plants (Eui1-OX) to the coi1-18 plant (Fig. 3D). The homozygous Eui1-OX/coi1-18 plants showed greatly reduced plant height (Fig. 3 A–C) and reduced cell size in the uppermost internode (Fig. 3 E and F), similar to Eui1-OX plants. In addition, the longer grain phenotype of the coi1-18 plants was also reverted to that of the WT (Fig. 3 G and H). We also crossed coi1-18 with the GA receptor gid1-1 mutant. Again, the gid1-1/coi1-18 double mutant exhibited a dwarf phenotype like gid1-1. This result demonstrated that the GA receptor gene GID1 is required for the function of OsCOI1 in the GA pathway. These results suggest that the OsCOI1-RNAi morphology is dependent on the GA signaling pathway.
| |
| − | [[File:7.jpg]]
| |
| − | | |
| − | | |
| − | Fig. 3. The GA-deficiency mutation reverses the phenotype of coi1-18plants. (A) Morphological phenotype of Eui1-OX/coi1-18. (B) The average plant height of WT, coi1-18, Eui1-OX, and Eui1-OX/coi1-18 plants. (C) The length of each internode of coi1-18 decreased in the Eui1-OX/coi1-18 plants. (D) Expression of OsCOI1 in Eui1-OX/coi1-18. (E and F) Cell lengths at the bases of the uppermost internodes in coi1-18, Eui1-OX/coi1-18, and Eui1-OX plants. (Scale bar, 40 μm.) (G and H) Grain lengths of coi1-18, Eui1-OX/coi1-18, and Eui1-OX plants. Letters on the columns in B, C, F, and H indicate significant differences determined by Tukey–Kramer multiple comparison test (P < 0.05).
| |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| − | The rice genome contains two closely related COI1genes, OsCOI1a(Os01g0853400) and OsCOI1b(Os05g0449500), which share 83% and 82% sequence identity at the DNA and protein levels, respectively. | + | * The rice genome contains two closely related COI1 genes, OsCOI1a(Os01g0853400) and OsCOI1b(Os05g0449500), which share 83% and 82% sequence identity at the DNA and protein levels, respectively. |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | National Key Laboratory of Plant Molecular Genetics, Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy
| + | * State Key Laboratory of Conservation and Utilization of Subtropical Agro-bioresources, Ministry of Agriculture, South China Agricultural University, Wushan, Guangzhou,People’s Republic of China, |
| − | of Sciences, Shanghai 200032, China; | + | * Key Laboratory of Tropical Agro-environment, Ministry of Agriculture, South China Agricultural University, Wushan, Guangzhou, People’s Republic of China |
| | + | * Plant Protection Institute, Guangdong Academy of Agricultural Sciences of China, Guangzhou, People’s Republic of China, |
| | + | * College of Life Sciences, South China Agricultural University, Wushan, Guangzhou, People’s Republic of China |
| | + | * Department of Entomology, Texas A&M University, College Station, Texas, United States of America |
| | | | |
| | ==References== | | ==References== |
| − | Yang, D.L., et al., Plant hormone jasmonate prioritizes defense over growth by interfering with gibberellin signaling cascade. Proc Natl Acad Sci U S A, 2012. 109(19): p. E1192-200.
| + | <references> |
| | + | * <ref name="ref1"> |
| | + | Ye M, Luo SM, Xie JF, Li YF, Xu T, Liu Y, Song YY, Zhu-Salzman K, Zeng RS. |
| | + | silencing COI1 in rice increases susceptibility to chewing insects and impairs |
| | + | inducible defense. PLoS One. 2012;7(4):e36214. doi: 10.1371/journal.pone.0036214. |
| | + | PubMed PMID: 22558386; PubMed Central PMCID: PMC3338713. |
| | + | </ref> |
| | + | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]] |
| − | GeneName = Os01g0853400|
| |
| − | Description = Similar to Coronatine-insensitive protein 1 (F-box/LRR-repeat protein 2) (AtFBL2) (COI-1) (AtCOI1)|
| |
| − | Version = NM_001051366.2 GI:297597978 GeneID:4324818|
| |
| − | Length = 3825 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os01g0853400, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
| |
| − | AP = Chromosome 1:38502654..38506478|
| |
| − | CDS = 38502654..38502710,38503400..38503953,38505117..38505591,38505672..38506478|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008394:38502654..38506478
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008394:38502654..38506478
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgcctccgtatgaaacagctagggcagagccagccagcaacaacaagcagcggccgatctccggcgagacggccgctgggagcagccgatccggccccgatccgatgggtggcgaggtgccggagccgcggcggctcaaccgggcgctcagcttcgacgactgggtccccgacgaggcgctgcacctcgtgatgggccacgtcgaggacccgcgggacagggaggcggcgtcgcgggtgtgccgccgctggcaccgcatcgacgcgctcacgcgcaagcacgtcaccgtcgccttctgctacgccgcgcgccccgcgcgcctccgggagcggttcccgcggctcgagtcgctctcgctcaagggcaagccccgcgccgccatgtacgggctcatccccgacgactggggcgcctacgccgcgccatggatcgacgagctcgccgcgccgctcgagtgcctcaaggcgctccacctccgccgcatgaccgtcaccgacgccgacatcgccgcccttgtccgcgcccgcggacacatgctgcaggagctcaagctcgacaagtgcatcggcttctccactgacgccctccgcctcgtcgcccgctcgtgcagatccctgagaactttatttctggaagagtgccatattactgataagggtggtgaatggcttcatgaacttgctgtcaacaattctgttctggtgacactgaacttctacatgactgaactcaaagtggcgccagctgatctagagcttcttgcaaagaattgcaagtcattgatttcattgaagatgagtgagtgtgatctttcagatctgattagtttttttcaaacagccaatgcgctgcaagactttgctggaggagcattctacgaggtaggagagctcaccaagtatgaaaaagttaagttcccacccagattatgcttcttggggcttacctacatgggaacaaatgagatgcctgttatcttccctttttcgatgaaactcaagaaactggacttgcaatacacttttctcacaacagaagatcattgtcagattattgcaaaatgtcccaatctactaattcttgaggtgaggaacgtgataggagatagagggctagaagttgttggtgatacatgcaagaagctacgaagactccgaattgagcggggtgatgatgatccaggtctgcaggaagagcaaggaggagtttctcagctaggcttgacagccgttgctgttggttgccgtgaattggagtacatagctgcctatgtatcggatatcaccaatggggccctggagtctattgggactttctgcaaaaatctatacgactttcggcttgtgctacttgacagagaaagacaggtaacagatctgccacttgacaatggtgtctgtgctctgttaagaaattgcacaaagcttcggaggtttgctctctaccttagaccaggagggctttcagatgatggccttagctacatcggacagtacagtggaaatatccaatacatgctactgggcaatgttggtgaatctgaccatggattgatccgtttcgcagtgggctgcaccaaccttcagaagcttgaattgagaagctgctgcttcagcgagcgagctttgtccctcgctgtactgcagatgccctccctgagatacatatgggtgcaaggatacagagcatctcaaacaggccttgacctcctgctcatggccaggcctttctggaacatcgagtttacacctccgagccctgagagttttaatcatatgacagaagatggagaaccctgtgtggatagccatgctcaggttcttgcctactattcccttgctggaaggaggtctgactgccctcagtgggtgatccccttgcatcctgcgtga</cdnaseq>|
| |
| − | AA = <aaseq>MPPYETARAEPASNNKQRPISGETAAGSSRSGPDPMGGEVPEPR RLNRALSFDDWVPDEALHLVMGHVEDPRDREAASRVCRRWHRIDALTRKHVTVAFCYA ARPARLRERFPRLESLSLKGKPRAAMYGLIPDDWGAYAAPWIDELAAPLECLKALHLR RMTVTDADIAALVRARGHMLQELKLDKCIGFSTDALRLVARSCRSLRTLFLEECHITD KGGEWLHELAVNNSVLVTLNFYMTELKVAPADLELLAKNCKSLISLKMSECDLSDLIS FFQTANALQDFAGGAFYEVGELTKYEKVKFPPRLCFLGLTYMGTNEMPVIFPFSMKLK KLDLQYTFLTTEDHCQIIAKCPNLLILEVRNVIGDRGLEVVGDTCKKLRRLRIERGDD DPGLQEEQGGVSQLGLTAVAVGCRELEYIAAYVSDITNGALESIGTFCKNLYDFRLVL LDRERQVTDLPLDNGVCALLRNCTKLRRFALYLRPGGLSDDGLSYIGQYSGNIQYMLL GNVGESDHGLIRFAVGCTNLQKLELRSCCFSERALSLAVLQMPSLRYIWVQGYRASQT GLDLLLMARPFWNIEFTPPSPESFNHMTEDGEPCVDSHAQVLAYYSLAGRRSDCPQWV IPLHPA</aaseq>|
| |
| − | DNA = <dnaseqindica>1..57#747..1300#2464..2938#3019..3825#atgcctccgtatgaaacagctagggcagagccagccagcaacaacaagcagcggccggtacgcaataatggaactctccataagccaagcagaggagagagcggtgcggatgcaacagagtactgagagaaaacagagtattttacgcactgttgtcggctagctgtatccgtttgcgtttcagggtaaatccatccatcatcgatccattcatggtggtgggctgctggtggtggtggtggtgctatgctacaggttaatttaggcgatgcttacgtgatgctaacacccagttaacgtggctagggctacgctaagcaaggagcattgaattcgatcgatatgttgggttttttctctttactagtagcatgccatctagtgtgcatcttacgtagtggaatattatcgggcacccaatattcggctcgcacaaagctccgaggacgaggaggaggacgactaatttggcagctcagctcacctgcacggctgcactgtgctgtgcccggtgggcgaagccatttcacccgcgggcttacgtggcccggcaccaccggccgagccgtgcggggaaacaagtaaacgctcgctcgctgcgtctccgatgcccccgtccccgcctggccgctgctgctctctcgctcttctccctccaataattcgcttgccctctggtggctcaaagcccagggaaattgatggagaagaattggggtagccccatgccacctggttcgggctagatctccggcgagacggccgctgggagcagccgatccggccccgatccgatgggtggcgaggtgccggagccgcggcggctcaaccgggcgctcagcttcgacgactgggtccccgacgaggcgctgcacctcgtgatgggccacgtcgaggacccgcgggacagggaggcggcgtcgcgggtgtgccgccgctggcaccgcatcgacgcgctcacgcgcaagcacgtcaccgtcgccttctgctacgccgcgcgccccgcgcgcctccgggagcggttcccgcggctcgagtcgctctcgctcaagggcaagccccgcgccgccatgtacgggctcatccccgacgactggggcgcctacgccgcgccatggatcgacgagctcgccgcgccgctcgagtgcctcaaggcgctccacctccgccgcatgaccgtcaccgacgccgacatcgccgcccttgtccgcgcccgcggacacatgctgcaggagctcaagctcgacaagtgcatcggcttctccactgacgccctccgcctcgtcgcccgctcgtgcaggtaacccaggagttctctctttcttgtactactcatctgtaacagtgattttttttacctccaatacttgcctaagcgaaagttagcagcagcaactgagcagttggtcttttcctcatttagaagttagggttgatctggtggaggtgctaattttgttgttagttggtgttcctaaatggagtaatggatagtagtgacatgttcttagtgttctaacatgggcaagcaaagttgagccaaccttgctcactttctggttcacaaattcctcccccccccccccctcgagaaaggagctgtcacaaattagcttccacagtccactcgtgactggttgaggccataacgcaccgaatttcaacagcaaaatttgtgagcattagatgcgcacaagatttttgcctcaatagatttgtgtggttctttcgtttacctactttcattatttcatctaattgtgtacttgttgagctgggtttgagaagagtccctaatacataaaaacaacttataagaggtagcaagtctggcataagcaatctgctataatttgaggcagacccataacggttggtcatatatcttttaccaggagtaagtactattgtaatggttggattgtacttgaaaaggactaccctgttcctccttagacatatttggaaccaaaatacagttgcaagttggggattatgttgccgccttgccggtcagttatatcatgctccgatttgtgcggcagtatgtcttgtctcatgtttcttgttaactttgcttagtttgactttgagttcgcaacaatgatgtcgcaccaattatccgttaaaaaaaatttataaagaacgcaagaatattttgtgctaaaggtatatatttatttttgagacctaacttgtgaagtctgcatgcatatggagatgtgtggggtggatgaccagtaataccttgtgtggaatgcatgtatgggatgctttgtgatggttggaagtacttcacaagtcactacacatctactatgagttgctatgtttcttgacttaaaatgtgattcctgttctttcctccaatatatatttcttctaacagcaatttcttcatgctcaatgctaagattacatgctatctctgcagtaacatgtcattctaaattatgtcaacagatccctgagaactttatttctggaagagtgccatattactgataagggtggtgaatggcttcatgaacttgctgtcaacaattctgttctggtgacactgaacttctacatgactgaactcaaagtggcgccagctgatctagagcttcttgcaaagaattgcaagtcattgatttcattgaagatgagtgagtgtgatctttcagatctgattagtttttttcaaacagccaatgcgctgcaagactttgctggaggagcattctacgaggtaggagagctcaccaagtatgaaaaagttaagttcccacccagattatgcttcttggggcttacctacatgggaacaaatgagatgcctgttatcttccctttttcgatgaaactcaagaaactggacttgcaatacacttttctcacaacagaagatcattgtcagattattgcaaaatgtcccaatctactaattcttgaggtaatatttcctgtatacaagcattgattaattgtgtttgaattagtatatgccatattacaacgagatgtcctcaacaggtgaggaacgtgataggagatagagggctagaagttgttggtgatacatgcaagaagctacgaagactccgaattgagcggggtgatgatgatccaggtctgcaggaagagcaaggaggagtttctcagctaggcttgacagccgttgctgttggttgccgtgaattggagtacatagctgcctatgtatcggatatcaccaatggggccctggagtctattgggactttctgcaaaaatctatacgactttcggcttgtgctacttgacagagaaagacaggtaacagatctgccacttgacaatggtgtctgtgctctgttaagaaattgcacaaagcttcggaggtttgctctctaccttagaccaggagggctttcagatgatggccttagctacatcggacagtacagtggaaatatccaatacatgctactgggcaatgttggtgaatctgaccatggattgatccgtttcgcagtgggctgcaccaaccttcagaagcttgaattgagaagctgctgcttcagcgagcgagctttgtccctcgctgtactgcagatgccctccctgagatacatatgggtgcaaggatacagagcatctcaaacaggccttgacctcctgctcatggccaggcctttctggaacatcgagtttacacctccgagccctgagagttttaatcatatgacagaagatggagaaccctgtgtggatagccatgctcaggttcttgcctactattcccttgctggaaggaggtctgactgccctcagtgggtgatccccttgcatcctgcgtga</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051366.2 RefSeq:Os01g0853400]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 1]]
| |
| − | [[Category:Chromosome 1]]
| |