Difference between revisions of "Os11g0704500"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os11g0592200''''' was reported as '''''OsMT1a''''' in 2009 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:231-Os11g0704500.png|right|thumb|427px|'''Figure 1 (Snapshot).''' ''Responses to drought of the OsMT1a-transgenic rice and wild type.<ref name="ref1" />.'']]
 +
 +
===Gene Symbol===
 +
*'''''Os11g0704500''''' '''''<=>''''' '''''OsMT1a''''','''''MT1a''''','''''MTa'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* Metallothioneins (MTs) are small, cysteine-rich, metal-binding proteins that may be involved in metal homeostasis and detoxification in both plants and animals.
 +
* OsMT1a, encodes a type 1 metallothionein.
 +
 
 +
===Phenotypic analysis===
 +
* Both transgenic plants and yeasts harboring OsMT1a accumulated more Zn(2+) than wild type controls, suggesting '''''OsMT1a''''' '''is most likely to be involved in zinc homeostasis'''.
 +
* Transgenic rice plants overexpressing '''''OsMT1a''''' demonstrated enhanced tolerance to drought.
 +
* The examination of antioxidant enzyme activities demonstrated that catalase (CAT), peroxidase (POD) and ascorbate peroxidase (APX) were significantly elevated in transgenic plants. Furthermore, the transcripts of several Zn(2+)-induced CCCH zinc finger transcription factors accumulated in '''''OsMT1a''''' transgenic plants, suggesting that '''''OsMT1a''''' '''not only participates directly in ROS scavenging pathway but also regulates expression of the zinc finger transcription factors via the alteration of Zn(2+) homeostasis, which leads to improved plant stress tolerance'''.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* Expression analysis revealed that OsMT1a predominantly expressed in the roots, and was induced by dehydration.  
 
+
* The OsMT1a expression was also induced specifically by Zn treatment.
===Evolution===
 
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* State Key Laboratory of Plant Genomics and National Center for Plant Gene Research (Beijing), Institute of Genetics and Developmental Biology, The Chinese Academy of Sciences, 100101 Beijing, China
 
 
 
==References==
 
==References==
Please input cited references here.
+
<references>
 
+
* <ref name="ref1">
 +
Yang Z, Wu Y, Li Y, Ling HQ, Chu C. OsMT1a, a type 1 metallothionein, plays
 +
the pivotal role in zinc homeostasis and drought tolerance in rice. Plant Mol
 +
Biol. 2009 May;70(1-2):219-29. doi: 10.1007/s11103-009-9466-1. PubMed PMID:
 +
19229638.
 +
</ref>
 +
</references>
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 11]]
GeneName = Os11g0704500|
 
Description = Metallothionein-like protein type 1|
 
Version = NM_001075076.1 GI:115486800 GeneID:4351213|
 
Length = 643 bp|
 
Definition = Oryza sativa Japonica Group Os11g0704500, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
 
AP = Chromosome 11:30636346..30636988|
 
CDS = 30636396..30636448,30636590..30636761|
 
GCID = <gbrowseImage1>
 
name=NC_008404:30636346..30636988
 
source=RiceChromosome11
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008404:30636346..30636988
 
source=RiceChromosome11
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgtcttgcagctgtggatctagctgcagctgcggctcaaactgctcctgcggaaagaagtaccctgacctggaagagaagagcagcagcaccaaggccaccgtcgtgctgggtgtggcgccggagaagaaggcgcagcagtttgaggcggccgcagagtccggcgagaccgcccatggctgcagctgcggttccagctgcaggtgcaacccttgcaactgctaa</cdnaseq>|
 
AA = <aaseq>MSCSCGSSCSCGSNCSCGKKYPDLEEKSSSTKATVVLGVAPEKK                    AQQFEAAAESGETAHGCSCGSSCRCNPCNC</aaseq>|
 
DNA = <dnaseqindica>51..103#245..416#tagttgatttcatcttcagttgcttgagcttaattacagactgagagaagatgtcttgcagctgtggatctagctgcagctgcggctcaaactgctcctgcgggtaattttcactgtaactttgctgacttgttcttgatttatagggcaatcttttcattattaatattctctaaatatgcagagtaatcgttgttgcagagttaattcttgtggtaactgattgatgttgattttgttgcagaaagaagtaccctgacctggaagagaagagcagcagcaccaaggccaccgtcgtgctgggtgtggcgccggagaagaaggcgcagcagtttgaggcggccgcagagtccggcgagaccgcccatggctgcagctgcggttccagctgcaggtgcaacccttgcaactgctaagatgcctgcctgcatctaccatctatcatgtgtgcgtgtgaattgtgatgcagaaaaataaagaagcttggccatttgggttggtgcttgaccaatatatatggggtgtgtgtgtgtgtgtgatgggttaatcgatgtgctatgttattggtttcactattcacgtactatgcttgtaatggtgtatccacagatgaagtgatgaatatattaaactggtttggcta</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001075076.1 RefSeq:Os11g0704500]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 11]]
 
[[Category:Chromosome 11]]
 

Latest revision as of 01:14, 15 February 2017

The rice Os11g0592200 was reported as OsMT1a in 2009 [1] by researchers from China.

Annotated Information

Figure 1 (Snapshot). Responses to drought of the OsMT1a-transgenic rice and wild type.[1].

Gene Symbol

  • Os11g0704500 <=> OsMT1a,MT1a,MTa

Function

  • Metallothioneins (MTs) are small, cysteine-rich, metal-binding proteins that may be involved in metal homeostasis and detoxification in both plants and animals.
  • OsMT1a, encodes a type 1 metallothionein.

Phenotypic analysis

  • Both transgenic plants and yeasts harboring OsMT1a accumulated more Zn(2+) than wild type controls, suggesting OsMT1a is most likely to be involved in zinc homeostasis.
  • Transgenic rice plants overexpressing OsMT1a demonstrated enhanced tolerance to drought.
  • The examination of antioxidant enzyme activities demonstrated that catalase (CAT), peroxidase (POD) and ascorbate peroxidase (APX) were significantly elevated in transgenic plants. Furthermore, the transcripts of several Zn(2+)-induced CCCH zinc finger transcription factors accumulated in OsMT1a transgenic plants, suggesting that OsMT1a not only participates directly in ROS scavenging pathway but also regulates expression of the zinc finger transcription factors via the alteration of Zn(2+) homeostasis, which leads to improved plant stress tolerance.

Expression

  • Expression analysis revealed that OsMT1a predominantly expressed in the roots, and was induced by dehydration.
  • The OsMT1a expression was also induced specifically by Zn treatment.

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Plant Genomics and National Center for Plant Gene Research (Beijing), Institute of Genetics and Developmental Biology, The Chinese Academy of Sciences, 100101 Beijing, China

References

  1. 1.0 1.1 Yang Z, Wu Y, Li Y, Ling HQ, Chu C. OsMT1a, a type 1 metallothionein, plays the pivotal role in zinc homeostasis and drought tolerance in rice. Plant Mol Biol. 2009 May;70(1-2):219-29. doi: 10.1007/s11103-009-9466-1. PubMed PMID: 19229638.

Structured Information