Difference between revisions of "Os06g0142350"

From RiceWiki
Jump to: navigation, search
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os06g0142350''''' was reported as '''''OsENOD93-1''''' in 2009 <ref name="ref1" /> by researchers from Canada.  
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
* Development of genetic varieties with improved nitrogen-use efficiency (NUE) is essential for sustainable agriculture.
 +
* The rice '''''OsENOD93-1''''' is an early nodulin gene with positive effects on nitrogen-use efficiency.
 +
* The '''''OsENOD93-1''''' gene responded significantly to both N induction and N reduction.
 +
 
 +
===Phenotypic analysis===
 +
* Transgenic rice plants over-expressing the OsENOD93-1 gene had increased shoot dry biomass and seed yield.
 +
* Transgenic plants accumulated higher concentrations of total amino acids and total N in roots.
 +
* A higher concentration of amino acids in xylem sap was detected in transgenic plants, especially under N stress.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* The '''''OsENOD93-1''''' gene was expressed at high levels in roots of wild-type (WT) plants
 +
* In situ hybridization revealed that '''''OsENOD93-1''''' is expressed in vascular bundles, as well as in epidermis and endodermis.
  
===Evolution===
+
===Subcellular localization===
Please input evolution information here.
+
* The '''''OsENOD93-1''''' protein product was localized in mitochondria.
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Department of Molecular and Cellular Biology, University of Guelph, Guelph, ON, Canada N1G 2W1,
 +
* Syngenta Biotechnology, Inc., Research Triangle Park, NC 27709, USA,
 +
* Department of Genetics, Fudan University, Shanghai 200433
 +
* Department of Plant Agriculture, University of Guelph, Guelph, ON, Canada N1G 2W1
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Bi YM, Kant S, Clarke J, Gidda S, Ming F, Xu J, Rochon A, Shelp BJ, Hao L,
 +
Zhao R, Mullen RT, Zhu T, Rothstein SJ. Increased nitrogen-use efficiency in
 +
transgenic rice plants over-expressing a nitrogen-responsive early nodulin gene
 +
identified from rice expression profiling. Plant Cell Environ. 2009
 +
Dec;32(12):1749-60. doi: 10.1111/j.1365-3040.2009.02032.x. Erratum in: Plant Cell
 +
Environ. 2010 Feb;33(2):304. Clark, Joseph [corrected to Clarke, Joseph]. PubMed
 +
PMID: 19682292.
 +
 
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 6]]
GeneName = Os06g0142350|
 
Description = Similar to Early nodulin|
 
Version = NM_001187664.1 GI:297724458 GeneID:9271477|
 
Length = 802 bp|
 
Definition = Oryza sativa Japonica Group Os06g0142350, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
 
AP = Chromosome 6:2207761..2208562|
 
CDS = 2207873..2208094,2208209..2208270,2208381..2208561|
 
GCID = <gbrowseImage1>
 
name=NC_008399:2207761..2208562
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008399:2207761..2208562
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>tctcatctcatctcgctcagcactactgatccaaccagtaggcgattctctccacctcccagctacttcacttcaggactagtttcttctcagctccatcgatcttgctcgacaatgtcgacgacggtgacccgtgctcacctggagcagaggctcgccctcgccaagcgctgctcccgggaggcgaaccttgcaggggttaaggcggctgctgtcgcgaccatcgcctctgccgttccaaccctggcgagcgtgaggatgctgccatgggcgaaggccaacatcaacccgacggggcaggcgctgatcatctgcacggcggccgggatggcatacttcgtcgccgccgacaagaagatcctctcgctggccaggaggcactccttcgagaacgcacctgaacacctcaagaacacctccttccagggcaccggccgccctcaccctgccttcttcaggccatga</cdnaseq>|
 
AA = <aaseq>SHLISLSTTDPTSRRFSPPPSYFTSGLVSSQLHRSCSTMSTTVT                    RAHLEQRLALAKRCSREANLAGVKAAAVATIASAVPTLASVRMLPWAKANINPTGQAL                    IICTAAGMAYFVAADKKILSLARRHSFENAPEHLKNTSFQGTGRPHPAFFRP</aaseq>|
 
DNA = <dnaseqindica>469..690#293..354#2..182#atctcatctcatctcgctcagcactactgatccaaccagtaggcgattctctccacctcccagctacttcacttcaggactagtttcttctcagctccatcgatcttgctcgacaatgtcgacgacggtgacccgtgctcacctggagcagaggctcgccctcgccaagcgctgctcccggggtacgtacgcacgcacactaaaccaccatgtttaatctcgctttgtcttgcattccatggcgctaataactgaatatatacaaactgatgtatgcttcgtcgatctgcagaggcgaaccttgcaggggttaaggcggctgctgtcgcgaccatcgcctctgccgttccaaccgtgagtgtgctcagatgctactagcttcttctaattcctccttgtgttgattcttcagcagagagtaggtgtactaacttattagctgcatatgtgtgttgtttcatcgatcagctggcgagcgtgaggatgctgccatgggcgaaggccaacatcaacccgacggggcaggcgctgatcatctgcacggcggccgggatggcatacttcgtcgccgccgacaagaagatcctctcgctggccaggaggcactccttcgagaacgcacctgaacacctcaagaacacctccttccagggcaccggccgccctcaccctgccttcttcaggccatgatcagcaagctagtgctgcttgcaatctgctgcagaaagtagctagtgttgtgtacttggatgtaatatactgtatgctccagcttgtattaataaacaatcttaatttgatg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001187664.1 RefSeq:Os06g0142350]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 6]]
 
[[Category:Chromosome 6]]
 

Latest revision as of 11:52, 2 March 2017

The rice Os06g0142350 was reported as OsENOD93-1 in 2009 [1] by researchers from Canada.

Annotated Information

Function

  • Development of genetic varieties with improved nitrogen-use efficiency (NUE) is essential for sustainable agriculture.
  • The rice OsENOD93-1 is an early nodulin gene with positive effects on nitrogen-use efficiency.
  • The OsENOD93-1 gene responded significantly to both N induction and N reduction.

Phenotypic analysis

  • Transgenic rice plants over-expressing the OsENOD93-1 gene had increased shoot dry biomass and seed yield.
  • Transgenic plants accumulated higher concentrations of total amino acids and total N in roots.
  • A higher concentration of amino acids in xylem sap was detected in transgenic plants, especially under N stress.

Expression

  • The OsENOD93-1 gene was expressed at high levels in roots of wild-type (WT) plants
  • In situ hybridization revealed that OsENOD93-1 is expressed in vascular bundles, as well as in epidermis and endodermis.

Subcellular localization

  • The OsENOD93-1 protein product was localized in mitochondria.

You can also add sub-section(s) at will.

Labs working on this gene

  • Department of Molecular and Cellular Biology, University of Guelph, Guelph, ON, Canada N1G 2W1,
  • Syngenta Biotechnology, Inc., Research Triangle Park, NC 27709, USA,
  • Department of Genetics, Fudan University, Shanghai 200433
  • Department of Plant Agriculture, University of Guelph, Guelph, ON, Canada N1G 2W1

References

  1. Bi YM, Kant S, Clarke J, Gidda S, Ming F, Xu J, Rochon A, Shelp BJ, Hao L, Zhao R, Mullen RT, Zhu T, Rothstein SJ. Increased nitrogen-use efficiency in transgenic rice plants over-expressing a nitrogen-responsive early nodulin gene identified from rice expression profiling. Plant Cell Environ. 2009 Dec;32(12):1749-60. doi: 10.1111/j.1365-3040.2009.02032.x. Erratum in: Plant Cell Environ. 2010 Feb;33(2):304. Clark, Joseph [corrected to Clarke, Joseph]. PubMed PMID: 19682292.

Structured Information