Difference between revisions of "Os05g0341600"

From RiceWiki
Jump to: navigation, search
(Expression)
(Gene Symbol)
 
(12 intermediate revisions by 4 users not shown)
Line 1: Line 1:
the rice gene '''Os05g0341600''' was recongized as '''RAB 21''' in 1988, which is induced when plants are subject to water-stress.
+
the rice gene '''Os05g0341600''' was recongized as '''''RAB21''''' in 1988, which is induced when plants are subject to water-stress.
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os05g0341600''''' '''<=>''' '''''OsRab5D1,Rab5D1,RAB21'''''
 +
[[File:Abscisic acid.png|right|thumb|200px|]]
 +
 
===Function===
 
===Function===
the rice gene '''Os05g0341600''' was recongized as '''RAB 21''' in 1988, which is induced to balance water-stress of plants. encoding a basic, glycine-rich protein (mol.wt 16 529) which has a duplicated domain structure. Immunoblots probed with antibodies raised against Bgalactosidase/RAB 21 fusion protein detect RAB 21 protein only in cytosolic cell fractions. <ref name="ref1" />
+
* the rice gene '''Os05g0341600''' was recongized as '''''RAB21''''' in 1988, which is induced to balance water-stress of plants. encoding a basic, glycine-rich protein (mol.wt 16 529) which has a duplicated domain structure.
 +
* Immunoblots probed with antibodies raised against Bgalactosidase/RAB 21 fusion protein detect RAB 21 protein only in cytosolic cell fractions. <ref name="ref1" /><ref name="ref1" /><ref name="ref2" /><ref name="ref3" />
 
===Expression===
 
===Expression===
RAB 21 mRNA and protein accumulate in rice embryos, leaves, roots and callus-derived suspension cells upon treatment with NaCl (200 mM) and/or the plant hormone abscisic acid (10 /tMABA). The effects of NaCI and ABA are not cumulative, suggesting that these two inducers share a common response pathway. Induction of RAB 21 mRNA accumulation by ABA is rapid (< 15 min in suspension cells) and does not require protein synthesis, indicating that preformed nuclear and/or cytosolic factors mediate the response to this hormone.the reseachers have characterized the RAB 21 gene by deternmining the complete nucleotide sequence of a nearly full-length cDNA and corresponding genomiccopy, and by mapping the start site of its major transcript. The proximal promoter region contains various GC-rich repeats.[[File:12343.png]]
+
* RAB 21 mRNA and protein accumulate in rice embryos, leaves, roots and callus-derived suspension cells upon treatment with NaCl (200 mM) and/or the plant hormone abscisic acid (10 /tMABA).  
 +
* The effects of NaCI and ABA are not cumulative, suggesting that these two inducers share a common response pathway. Induction of RAB 21 mRNA accumulation by ABA is rapid (< 15 min in suspension cells) and does not require protein synthesis, indicating that preformed nuclear and/or cytosolic factors mediate the response to this hormone.
 +
* the reseachers have characterized the RAB 21 gene by deternmining the complete nucleotide sequence of a nearly full-length cDNA and corresponding genomiccopy, and by mapping the start site of its major transcript. The proximal promoter region contains various GC-rich repeats.
  
 
===Knowledge Extension===
 
===Knowledge Extension===
The hormone abscisic acid (ABA) mediates a number of important physiological processes in plants (King, 1976;
+
* The hormone abscisic acid (ABA) mediates a number of important physiological processes in plants (King, 1976; Jones et al., 1987).
Jones et al., 1987). Developmental studies have shown that ABA induces the accumulation of specific mRNAs and
+
* Developmental studies have shown that ABA induces the accumulation of specific mRNAs and proteins late during embryogenesis in seeds of diverse species (Galau et al., 1986; Finklestein et al., 1985; Litts et al.,1987).  
proteins late during embryogenesis in seeds of diverse species (Galau et al., 1986; Finklestein et al., 1985; Litts et al.,1987). At this time, the level of endogenous ABA increases,the seeds desiccate and the embryos of some species become dormant (King, 1976; Suzuki et al., 1981). In cereal seeds,some of the 'late' developmental mRNAs are long-lived in mature, dry grains, but are rapidly degraded during seed germination. However, exogenously applied ABA causes the precocious accumulation of these mRNAs in immature embryos and their reappearance in germinating seeds (Finklestein et al., 1985; Mundy et al., 1986). [[File:Abscisic acid.png]]
+
* At this time, the level of endogenous ABA increases,the seeds desiccate and the embryos of some species become dormant (King, 1976; Suzuki et al., 1981).  
 +
* In cereal seeds,some of the 'late' developmental mRNAs are long-lived in mature, dry grains, but are rapidly degraded during seed germination.
 +
* However, exogenously applied ABA causes the precocious accumulation of these mRNAs in immature embryos and their reappearance in germinating seeds (Finklestein et al., 1985; Mundy et al., 1986).
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Laboratory of Plant Molecular Biology, Rockefeller University, 1230 York Avenue, New York, NY 10021, USA
+
* Laboratory of Plant Molecular Biology, Rockefeller University, 1230 York Avenue, New York, NY 10021, USA
  
 
==References==
 
==References==
 
<references>
 
<references>
 
<ref name="ref1">Mundy, J. and N.-H. Chua (1988). "Abscisic acid and water-stress induce the expression of a novel rice gene." The EMBO Journal 7(8): 2279.</ref>
 
<ref name="ref1">Mundy, J. and N.-H. Chua (1988). "Abscisic acid and water-stress induce the expression of a novel rice gene." The EMBO Journal 7(8): 2279.</ref>
 +
<ref name="ref2">Bray EA, Beachy RN. Regulation by ABA of beta-Conglycinin Expression in Cultured Developing Soybean Cotyledons. Plant Physiol. 1985 Nov;79(3):746–750.</ref>
 +
<ref name="ref3">Finkelstein RR, Tenbarge KM, Shumway JE, Crouch ML. Role of ABA in Maturation of Rapeseed Embryos. Plant Physiol. 1985 Jul;78(3):630–636.</ref>
 
</references>
 
</references>
 +
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os05g0341600|
 
Description = Similar to Ras-related protein Rab-21|
 
Version = NM_001061782.1 GI:115463294 GeneID:4338469|
 
Length = 4497 bp|
 
Definition = Oryza sativa Japonica Group Os05g0341600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
 
AP = Chromosome 5:15997018..16001514|
 
CDS = 15997421..15997539,15998086..15998174,15998470..15998635,15998717..15998777,15999640..15999776<br>,16001320..16001386|
 
GCID = <gbrowseImage1>
 
name=NC_008398:15997018..16001514
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008398:15997018..16001514
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgggctcgaagccgccgccgccgccgcagcccagcgtctccttcaagctcgtcctcctcggcgacgggagagtaggcaaaacatctcttgtgctgcggtatgtgaatgatgtcttctcagacaaacaggaagcaactgttcaagcttcatatttgacaaagcgccttgttgttgaaggtgtgcctattacgctctctatctgggatacagctggacaagagaagttccatgcactaggccctatatactatcgtgatgcagacgctgctcttttagtatatgacatcacagacaatgatacttttcttcgtgtcacaaagtgggtgaaagagcttaagcaaatggcaaataaagatattgttatggccattgcagcaaataaaagtgacctggttagatcaaaacacatagacactaatgaagcagcaagctatgcagaaagtattggggcaactctctttgttacttctgccaaagctggtactgggattgatgatatcttcagtgacatagccaagagattattagagagaagaaaaaacagctccgatggcttgtcactggctcatccaaagaaaggcattttaatcgtcgacgatgaacctgagaaagaacctccaccaaagtgctgctcatag</cdnaseq>|
 
AA = <aaseq>MGSKPPPPPQPSVSFKLVLLGDGRVGKTSLVLRYVNDVFSDKQE                    ATVQASYLTKRLVVEGVPITLSIWDTAGQEKFHALGPIYYRDADAALLVYDITDNDTF                    LRVTKWVKELKQMANKDIVMAIAANKSDLVRSKHIDTNEAASYAESIGATLFVTSAKA                    GTGIDDIFSDIAKRLLERRKNSSDGLSLAHPKKGILIVDDEPEKEPPPKCCS</aaseq>|
 
DNA = <dnaseqindica>3976..4094#3341..3429#2880..3045#2738..2798#1739..1875#129..195#tcccacacttctcctctctgaccacagcacacacgcaacaccgggacgggcgatccggaaggttctggaaccttctagaggctcgtaggagcctccggcggaacccctctcgcctcgcctcgcctccgatgggctcgaagccgccgccgccgccgcagcccagcgtctccttcaagctcgtcctcctcggcgacggtacggctatctccctctcccttccgatcccgcgaaccctcctcccccccttctcaacccccttttctgccgaattcccgatccttcagtttggggttggcgtgcgcaagaaaatagccacggaatctgggtgaattttggctgctcttgtggtgcgtgctgagccctagctagggttaggggaaagccgcagaatcatttgatctggtaccctgtgtaggtagctaaatctatagcttagacgagggagttgagcggttttgagctaagcttaccttttacttgattgccttcgaggcttagcggagtccaggagatgattagaccgagagggctactcatagaaacaatctaacaagtagaagcatattcgttcttatatagaagatttgtctagtgctagctgcagcggggactgctgcaaattcatgtggacacaaagtggcagctgaagggtggccatggagctggtggcagggaattcgtcttatgcaataggggtggataatatttcattttgatccgtgctctctgtccgcttttaagcttggattgtaatgtccagctgatctagttctatattaattggtggttttacttttcttgtcattaccttaaccaacccttgaaggcagggtcctagaaaaaaaaaattcagtatgactcagctttttggtcatctgtgtatgatgccatgggtcttacccatgttcctctagagaaagtgatgtgtgcctttttggaaaaatgatacagtatgtagtttgggaggagggggttttgatgggaaagtactacagtctttatttgggcatgcttcttagcaagtgcatgtaagtcatacatgggaatgtcaagagaatttttcttgaaaccaggcacgggtgggcattgatctaacatggtacacttgcttttcctagcattgttgaacattgactcattttgatttaggatcagcttacttatagcttagaagcaagcttggaaatcagtttgtgcattgccaaagcggaatcacgtttcatttgaagttggctaatttcaattttggaaaagaaaaaagttggagtagttttgaactgaggcaatgagcacaatgaaagaattttttaccacagtagacagtacttgataagtgatagcgccagcataatcaattgctgaaactctttaaccatgccttagtacttggctttacattttttgaatgaagatatatatgtgtttccatgcataaaagcattgttgatagtcttgtgggcatgtatcttataggttgggtcattagggtttgcttattgttataactttctgtcattgatttcagatttttaatggaagaggtgtttaggctgtcttgtaaccagtcctctgttggcccagcctatcaatgtgaaaactgataaacctaagtttaacttaggatgaattgatcataattatatgctccattttttcaatttcattgaaaagacatgtgattgaatacatttcatatttattaacacaaacaataacttttacttttctcttggcacagggagagtaggcaaaacatctcttgtgctgcggtatgtgaatgatgtcttctcagacaaacaggaagcaactgttcaagcttcatatttgacaaagcgccttgttgttgaaggtgtgcctattacgctctctatctgggtgcgttgtcatctctttgatttgcgataatttgttcaacattttttacctctttcattttctcttatgtcagttgcacacacttgtttgaagtaattgtttactaattttgctgttgggatgatattcaattatggtttcaaatcccacttatatgtgcccttgtatcagaaatcctagtaggagtcagaaaaggtgaaaccaacccaattttgttggattataatacgagattgggaatatttagagatatgtggacttagttcttcattaaaaaaggagtaaatttcatagaactacggatattttgacaaaactatcacagaactacagatttaaggtcaaatttatcccaaaactacagatttaaataaaactgttacatggtttgcttccattatagctaaagtccgagactctgtgtacttgaactcatgaagccaaacattagattgcttggacatgttcagctggcatacaacttgtctacaggtttcacggaaatgggaatgattaggtttattactctcctgttgattgatttgactctcattttgttgattgcctttttaatttaagtaagattttatcagtatggttgtgttcagttttttactgatgtgacggtatccttcatggaaatcttaaatctttaccagaatactgaaactagactttggtcctccttttggttagtttgtaggctttgcttgttctatcaacaaaagtatatttgctaccagtgactgccttctataactgagtaataacttatttccacgcgctggtcacttggttgtctcctttactttaagttcttcctgcaagatttttttagtatttaatttttcttggtttgcaggatacagctggacaagagaagttccatgcactaggccctatatactatcgtgatgcagacggtaatattcgtcttcttgttttgaattaaatatatcgaggtggatcactaaattcttttttatatcttttgatgactgcagctgctcttttagtatatgacatcacagacaatgatacttttcttcgtgtcacaaagtgggtgaaagagcttaagcaaatggcaaataaagatattgttatggccattgcagcaaataaaagtgacctggttagatcaaaacacatagacactaatgaagcagcaaggtattcttctttgttatcagttacaaatactacacagccaaaatatgtaatattgccctggtacttgagttagcaacttagcatcgttagtctttgagtagaacaaaagaaatatatgtgatatatactttatctgttgattaaactatttagatatatcagcatagtttcaacatataatctgcaatccttttatgattgtacagtttcttgaaaatgcgttcttttagttccatatttcctcttctctatctatttcatctaagtaatattgttactacatgtacatctccagctatgcagaaagtattggggcaactctctttgttacttctgccaaagctggtactgggattgatgatatcttcagtgacatagccaagagtaagtcttattgtgttagctattgctttcaattcatctccacatttttgccactttaacaaatactgctttgccaaaacttataagttgtaacattcagctattccattagaatgcggggtcatcaacgatagcatatagtttagttaacaatttcatgtttcactctattgagcagatttcgtttatcaaactcaattgttattcctcagattaatccattgtataacactcaatatttgcgaattccctcttcatctcaataacaaggtgggtatggacccacatgtcattggtatagaatgctgtattcgaagtggctatgttgtatgtagtttgtctagagctattcttgcaatgacataacttgcaataaatggatatgtatgcattcttaatcctactgattttctggacttgtcaccagggaattcaaacactgctaacatggaactatttatttccttttaagctgttgaaaatcgtatgtccctaactgattggtggttttcttaattgctatgccctcactaccgtttgttgtaggattattagagagaagaaaaaacagctccgatggcttgtcactggctcatccaaagaaaggcattttaatcgtcgacgatgaacctgagaaagaacctccaccaaagtgctgctcatagcgagattccaatgcaaatcacgtgggcataatgtcatagaaacctgcaattgatatgtgaaggatcaaatccttgcattaactttgctcatgctcttttggagctcaggagcaatgcaagtgtatactggttgattatttttagcttgtgtaaatactaaactcagttcatgaaattgttgtcaaatatagttgttcgatgatgacgattcgatatgccgaagaagttcatggccctttgtatatctgtaactcacaggttgcttatttactagctgttgttttgagggggttattttgatcatgtgcgtcgaaataattgtgtcgtgttgactgctgagtgtacatgtatcgtggttattccatctgaacctgcaatgtaaagcttccgtcccaattcccaa</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001061782.1 RefSeq:Os05g0341600]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 15:19, 6 May 2017

the rice gene Os05g0341600 was recongized as RAB21 in 1988, which is induced when plants are subject to water-stress.

Annotated Information

Gene Symbol

  • Os05g0341600 <=> OsRab5D1,Rab5D1,RAB21
Abscisic acid.png

Function

  • the rice gene Os05g0341600 was recongized as RAB21 in 1988, which is induced to balance water-stress of plants. encoding a basic, glycine-rich protein (mol.wt 16 529) which has a duplicated domain structure.
  • Immunoblots probed with antibodies raised against Bgalactosidase/RAB 21 fusion protein detect RAB 21 protein only in cytosolic cell fractions. [1][1][2][3]

Expression

  • RAB 21 mRNA and protein accumulate in rice embryos, leaves, roots and callus-derived suspension cells upon treatment with NaCl (200 mM) and/or the plant hormone abscisic acid (10 /tMABA).
  • The effects of NaCI and ABA are not cumulative, suggesting that these two inducers share a common response pathway. Induction of RAB 21 mRNA accumulation by ABA is rapid (< 15 min in suspension cells) and does not require protein synthesis, indicating that preformed nuclear and/or cytosolic factors mediate the response to this hormone.
  • the reseachers have characterized the RAB 21 gene by deternmining the complete nucleotide sequence of a nearly full-length cDNA and corresponding genomiccopy, and by mapping the start site of its major transcript. The proximal promoter region contains various GC-rich repeats.

Knowledge Extension

  • The hormone abscisic acid (ABA) mediates a number of important physiological processes in plants (King, 1976; Jones et al., 1987).
  • Developmental studies have shown that ABA induces the accumulation of specific mRNAs and proteins late during embryogenesis in seeds of diverse species (Galau et al., 1986; Finklestein et al., 1985; Litts et al.,1987).
  • At this time, the level of endogenous ABA increases,the seeds desiccate and the embryos of some species become dormant (King, 1976; Suzuki et al., 1981).
  • In cereal seeds,some of the 'late' developmental mRNAs are long-lived in mature, dry grains, but are rapidly degraded during seed germination.
  • However, exogenously applied ABA causes the precocious accumulation of these mRNAs in immature embryos and their reappearance in germinating seeds (Finklestein et al., 1985; Mundy et al., 1986).

Labs working on this gene

  • Laboratory of Plant Molecular Biology, Rockefeller University, 1230 York Avenue, New York, NY 10021, USA

References

  1. 1.0 1.1 Mundy, J. and N.-H. Chua (1988). "Abscisic acid and water-stress induce the expression of a novel rice gene." The EMBO Journal 7(8): 2279.
  2. Bray EA, Beachy RN. Regulation by ABA of beta-Conglycinin Expression in Cultured Developing Soybean Cotyledons. Plant Physiol. 1985 Nov;79(3):746–750.
  3. Finkelstein RR, Tenbarge KM, Shumway JE, Crouch ML. Role of ABA in Maturation of Rapeseed Embryos. Plant Physiol. 1985 Jul;78(3):630–636.

Structured Information