Difference between revisions of "Os12g0555600"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os12g0555600| Description = Similar to CSLD4 (Fragment)| Version = NM_001073531.1 GI:115489023 GeneID:4352492| Length = 1184 bp| Definition = O...")
 
(Annotated Information)
 
(6 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os12g0555600''''' was reported as '''''CSLD4''''' in 2013 by researchers from Japan.
GeneName = Os12g0555600|
+
==Annotated Information==
Description = Similar to CSLD4 (Fragment)|
+
===Gene Symbol===
Version = NM_001073531.1 GI:115489023 GeneID:4352492|
+
*'''''Os12g0555600''''' '''''<=>''''' '''''CD1, CSLD4, DNL3, OsCD1, OsCSLD4'''''
Length = 1184 bp|
+
[[File:Figure 1.jpg|200px|thumb|right|Fig.1.Vegetative phenotypes of wild-type and mutation]]
Definition = Oryza sativa Japonica Group Os12g0555600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
===Function===
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
* Cellulose synthase-like (CSL) genes are predicted to catalyse the biosynthesis of non-cellulosic polysaccharides such as the β-d-glycan backbone of hemicelluloses and are classified into nine subfamilies (CSLA–CSLH and CSLJ).
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
* The CSLD subfamily is conserved in all land plants, and among the nine CSL subfamilies, it shows the highest sequence similarity to the cellulose synthase genes, suggesting that it plays fundamental roles in plant development.  
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
 
|
+
===Phenotypic analysis===
Chromosome = [[:category:Japonica Chromosome 12|Chromosome 12]]|
+
* The mutants of csld4 showed rolled and narrow leaf blades and a reduction in plant height(figure1).  
AP = Chromosome 12:22807006..22808189|
+
* The narrow leaf blade of sle1 was caused by reduced cell proliferation beginning at the P3 primordial stage (figure 2).
CDS = 22807006..22808187|
+
* In addition to the size reduction of organs, sle1 mutants exhibited serious developmental defects in pollen formation , anther dehiscence(figure 3), stomata formation, and cell arrangement in various tissues.
GCID = <gbrowseImage1>
+
 
name=NC_008405:22807006..22808189
+
===Expression===
source=RiceChromosome12
+
* In situ hybridization experiments showed that OsCSLD4 was expressed in a patchy pattern in developing organs(figure 4). Double-target in situ hybridization and quantitative RT-PCR analyses revealed that SLE1 was expressed specifically during the M-phase of the cell cycle(figure 5), and suggested that the cell-cycle regulation was altered in sle1 mutants. These results suggest that the OsCSLD4 protein plays a pivotal role in the M phase to regulate cell proliferation.
preset=GeneLocation
+
 
</gbrowseImage1>|
+
==Labs working on this gene==
GSID = <gbrowseImage2>
+
* Graduate School of Agricultural and Life Sciences, University of Tokyo, 1-1-1, Yayoi, Bunkyo-ku, Tokyo, 113–8657, Japan
name=NC_008405:22807006..22808189
+
* National Institute of Genetics, 1111 Yata, Mishima, Shizuoka, 411–8540, Japan
source=RiceChromosome12
+
 
preset=GeneLocation
+
==References==
</gbrowseImage2>|
+
1. Takanori Yoshikawa;Mitsugu Eiguchi;Ken-Ichiro Hibara;Jun-Ichi Ito;Yasuo Nagato, Rice SLENDER LEAF 1 gene encodes cellulose synthase-like D4 and is specifically expressed in M-phase cells to regulate cell proliferation. Journal of Experimental Botany, 2013, 64(7): 2049-2061
CDNA = <cdnaseq>aagctgttcctcaccaagaagaagagcatgggcaagaagacggacagggccgaggacgacaccgagatgatgctgccgccgatcgaggacgacgacggcggcgccgacattgaggcctcggctatgctaccgaagcggttcggcgggtcggcgacgttcgtggcgtcgatacccgtggcggagtaccagggtcggctgctgcaggacacccccgggtgccaccacggccgccctgcgggcgcgctcgctgtgccgcgcgagccgctcgacgcggcgacggtggcggaggccatcggcgtgatctcctgcttctacgaggagaagacggagtgggggcggcgcatcgggtggatctacggctccgtcaccgaggacgtggtcaccggctaccggatgcacaaccgcgggtggcgctccgtctactgcgtgacgccgcggcgcgacgcgttccgcggcacggcgccgatcaacctcaccgaccgcctccaccaggtgctccggtgggcgacgggctccgtcgagatcttcttctcccgcaacaacgccctcttcgcctcgccgcggatgaagctgctgcagcgcgtcgcctacttcaacgccgggatgtaccccttcacctccgtgttcctcctcgcctactgcctcctcccggccgtctccctcttctccggcaagttcatcgtgcagcgactcagcgccaccttcctcgccttcctcctcgtcatcaccctcaccctctgcctcctcgccctgctcgagatcaagtggtccgggatcacgctccacgagtggtggcgcaacgagcagttctgggtgatcggcggcaccagcgcgcacccggccgccgtgctgcagggcctactcaaggtgatcgccggcgtggacatctccttcacgctgacctccaagccggggaacggcggcggcgatggcggggtcggcggcgaggggaacgacgacgaggcgttcgcggagctgtacgaggtgaggtggagctacctgatggtgccgccggtgacgatcatgatggtgaacgcggtggcgatcgcggtggcggcggcgaggacgctgtacagcgagttcccgcagtggagcaagctgctcggcggcgccttcttcagcttctgggtgctgtgccacctctacccgttcgccaagggcctcctcggccgccgcggccgc</cdnaseq>|
+
 
AA = <aaseq>KLFLTKKKSMGKKTDRAEDDTEMMLPPIEDDDGGADIEASAMLP                    KRFGGSATFVASIPVAEYQGRLLQDTPGCHHGRPAGALAVPREPLDAATVAEAIGVIS                    CFYEEKTEWGRRIGWIYGSVTEDVVTGYRMHNRGWRSVYCVTPRRDAFRGTAPINLTD                    RLHQVLRWATGSVEIFFSRNNALFASPRMKLLQRVAYFNAGMYPFTSVFLLAYCLLPA                    VSLFSGKFIVQRLSATFLAFLLVITLTLCLLALLEIKWSGITLHEWWRNEQFWVIGGT                    SAHPAAVLQGLLKVIAGVDISFTLTSKPGNGGGDGGVGGEGNDDEAFAELYEVRWSYL                    MVPPVTIMMVNAVAIAVAAARTLYSEFPQWSKLLGGAFFSFWVLCHLYPFAKGLLGRR                    GR</aaseq>|
+
2. Jiang Hu;Li Zhu;Dali Zeng;Zhenyu Gao;Longbiao Guo;Yunxia Fang;Guangheng Zhang;Guojun Dong;Meixian Yan;Jian Liu;Qian Qian.. Identification and characterization of NARROW AND ROLLED LEAF 1, a novel gene regulating leaf morphology and plant architecture in rice. Plant Molecular Biology, 2010, 73(3): 283-292
DNA = <dnaseqindica>3..1184#tcaagctgttcctcaccaagaagaagagcatgggcaagaagacggacagggccgaggacgacaccgagatgatgctgccgccgatcgaggacgacgacggcggcgccgacattgaggcctcggctatgctaccgaagcggttcggcgggtcggcgacgttcgtggcgtcgatacccgtggcggagtaccagggtcggctgctgcaggacacccccgggtgccaccacggccgccctgcgggcgcgctcgctgtgccgcgcgagccgctcgacgcggcgacggtggcggaggccatcggcgtgatctcctgcttctacgaggagaagacggagtgggggcggcgcatcgggtggatctacggctccgtcaccgaggacgtggtcaccggctaccggatgcacaaccgcgggtggcgctccgtctactgcgtgacgccgcggcgcgacgcgttccgcggcacggcgccgatcaacctcaccgaccgcctccaccaggtgctccggtgggcgacgggctccgtcgagatcttcttctcccgcaacaacgccctcttcgcctcgccgcggatgaagctgctgcagcgcgtcgcctacttcaacgccgggatgtaccccttcacctccgtgttcctcctcgcctactgcctcctcccggccgtctccctcttctccggcaagttcatcgtgcagcgactcagcgccaccttcctcgccttcctcctcgtcatcaccctcaccctctgcctcctcgccctgctcgagatcaagtggtccgggatcacgctccacgagtggtggcgcaacgagcagttctgggtgatcggcggcaccagcgcgcacccggccgccgtgctgcagggcctactcaaggtgatcgccggcgtggacatctccttcacgctgacctccaagccggggaacggcggcggcgatggcggggtcggcggcgaggggaacgacgacgaggcgttcgcggagctgtacgaggtgaggtggagctacctgatggtgccgccggtgacgatcatgatggtgaacgcggtggcgatcgcggtggcggcggcgaggacgctgtacagcgagttcccgcagtggagcaagctgctcggcggcgccttcttcagcttctgggtgctgtgccacctctacccgttcgccaagggcctcctcggccgccgcggccgc</dnaseqindica>|
+
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001073531.1 RefSeq:Os12g0555600]|
+
3. Chao Wu;Yaping Fu;Guocheng Hu;Huamin Si;Shihua Cheng;Wenzhen Liu. Isolation and characterization of a rice mutant with narrow and rolled leaves. Planta, 2010, 232(2): 313-324
}}
+
 
[[Category:Genes]]
+
==Structured Information==
[[Category:Japonica mRNA]]
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 12]]
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 12]]
 
[[Category:Chromosome 12]]
 

Latest revision as of 01:55, 7 May 2017

The rice Os12g0555600 was reported as CSLD4 in 2013 by researchers from Japan.

Annotated Information

Gene Symbol

  • Os12g0555600 <=> CD1, CSLD4, DNL3, OsCD1, OsCSLD4
Fig.1.Vegetative phenotypes of wild-type and mutation

Function

  • Cellulose synthase-like (CSL) genes are predicted to catalyse the biosynthesis of non-cellulosic polysaccharides such as the β-d-glycan backbone of hemicelluloses and are classified into nine subfamilies (CSLA–CSLH and CSLJ).
  • The CSLD subfamily is conserved in all land plants, and among the nine CSL subfamilies, it shows the highest sequence similarity to the cellulose synthase genes, suggesting that it plays fundamental roles in plant development.

Phenotypic analysis

  • The mutants of csld4 showed rolled and narrow leaf blades and a reduction in plant height(figure1).
  • The narrow leaf blade of sle1 was caused by reduced cell proliferation beginning at the P3 primordial stage (figure 2).
  • In addition to the size reduction of organs, sle1 mutants exhibited serious developmental defects in pollen formation , anther dehiscence(figure 3), stomata formation, and cell arrangement in various tissues.

Expression

  • In situ hybridization experiments showed that OsCSLD4 was expressed in a patchy pattern in developing organs(figure 4). Double-target in situ hybridization and quantitative RT-PCR analyses revealed that SLE1 was expressed specifically during the M-phase of the cell cycle(figure 5), and suggested that the cell-cycle regulation was altered in sle1 mutants. These results suggest that the OsCSLD4 protein plays a pivotal role in the M phase to regulate cell proliferation.

Labs working on this gene

  • Graduate School of Agricultural and Life Sciences, University of Tokyo, 1-1-1, Yayoi, Bunkyo-ku, Tokyo, 113–8657, Japan
  • National Institute of Genetics, 1111 Yata, Mishima, Shizuoka, 411–8540, Japan

References

1. Takanori Yoshikawa;Mitsugu Eiguchi;Ken-Ichiro Hibara;Jun-Ichi Ito;Yasuo Nagato, Rice SLENDER LEAF 1 gene encodes cellulose synthase-like D4 and is specifically expressed in M-phase cells to regulate cell proliferation. Journal of Experimental Botany, 2013, 64(7): 2049-2061

2. Jiang Hu;Li Zhu;Dali Zeng;Zhenyu Gao;Longbiao Guo;Yunxia Fang;Guangheng Zhang;Guojun Dong;Meixian Yan;Jian Liu;Qian Qian.. Identification and characterization of NARROW AND ROLLED LEAF 1, a novel gene regulating leaf morphology and plant architecture in rice. Plant Molecular Biology, 2010, 73(3): 283-292

3. Chao Wu;Yaping Fu;Guocheng Hu;Huamin Si;Shihua Cheng;Wenzhen Liu. Isolation and characterization of a rice mutant with narrow and rolled leaves. Planta, 2010, 232(2): 313-324

Structured Information