Difference between revisions of "Os03g0237200"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os03g0237200| Description = Conserved hypothetical protein| Version = NM_001056029.2 GI:297600615 GeneID:4332188| Length = 2287 bp| Definition ...")
 
 
(3 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os03g0237200''''' was reported as '''''LPA1''''' in 2015 <ref name="ref1" /> by researchers from Korea and Japan.  
GeneName = Os03g0237200|
 
Description = Conserved hypothetical protein|
 
Version = NM_001056029.2 GI:297600615 GeneID:4332188|
 
Length = 2287 bp|
 
Definition = Oryza sativa Japonica Group Os03g0237200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Function===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
* Loose Plant Architecture1 (LPA1) determines lamina joint bending by suppressing auxin signalling that interacts with C-22-hydroxylated and 6-deoxo brassinosteroids in rice.
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
 
|
+
===Phenotypic analysis===
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
+
* The researchers examined the mode of action of LPA1 on lamina bending by comparing the phenotypes among knockout, overexpression and repressor-fusion transgenic plants.
AP = Chromosome 3:7286641..7288927|
+
* A strong synergic effect is detected between lpa1 and d2 (the defective mutant for catalysis of C-23-hydroxylated BRs) during IAA-mediated lamina inclination.
CDS = 7286641..7287310,7288899..7288927|
+
 
GCID = <gbrowseImage1>
+
===Expression===
name=NC_008396:7286641..7288927
+
* The Ubiquitin promoter was used to overexpress LPA1 cDNA. To construct a vector expressing repressor-fused LPA1, the C-terminus of LPA1 was fused with the 24 amino acid fragment containing a conserved ERF-associated amphiphilic repression (EAR) motif of a gene (LOC_Os02g01090) orthologous to Arabidopsis SUPERMAN (At3g23130).
source=RiceChromosome03
+
* RNA sequencing analysis and qRT-PCR indicate that LPA1 influences the expression of three OsPIN genes (OsPIN1a, OsPIN1c and OsPIN3a), which suggests that auxin flux might be an important factor in LPA1-mediated lamina inclination in rice.
preset=GeneLocation
+
 
</gbrowseImage1>|
+
You can also add sub-section(s) at will.
GSID = <gbrowseImage2>
+
 
name=NC_008396:7286641..7288927
+
==Labs working on this gene==
source=RiceChromosome03
+
* State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou, China;
preset=GeneLocation
+
* Department of Biology - Plant Biology, University of Fribourg, Rue Albert-Gockel 3, CH-1700 Fribourg, Switzerland
</gbrowseImage2>|
+
* State Key Laboratory of Plant Genomics, National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.
CDNA = <cdnaseq>atggctggttgttgtagtcctaactcaaaagtggagagcttcatagagcaccaggatgcgtgtaactctggacgtgtgcgcggtgaggtcgtgcccgtggccacgacgctgccggtcatccgtcccgcggcgctgcggcatcatcaccatcatccgccgccgccgccgcctgagctgcagctcctcccggcgtccaccacggcgccgttggccgccgcgttctcgtccaactccacgaccaccggctcctcctcccacgagcaacacgcgacgacgatgacaacgacgaagctgcagctctcaatcggccccgccgccgtcgtcgccgcggcgtccggcggcggcggcgcctgcgccgcggcggcaggaggggaggaggagcagcagcgggaagaggtgaggcgcgcgctggaggagaagaccgcggcggacgcggcgcgggagcgggcgcgcgaggaggccgcggcggcggagcgcgcgctggaggacgcccgccgcgcgcgccaccgggcgcgcggggagctcgagaaggcgctcgcgctgcgggaccacgcggcgcgcctgatcgcgcaggtgacctgccacgcgtgccggcagcgctcgctcgccgtgatgtccatggccgccatcgacggccacggcgcgtcggcggtggcgcgcgagcacctgaggggcggcggcgtcggcgccggcatctag</cdnaseq>|
+
* State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou, China
AA = <aaseq>MAGCCSPNSKVESFIEHQDACNSGRVRGEVVPVATTLPVIRPAA                    LRHHHHHPPPPPPELQLLPASTTAPLAAAFSSNSTTTGSSSHEQHATTMTTTKLQLSI                    GPAAVVAAASGGGGACAAAAGGEEEQQREEVRRALEEKTAADAARERAREEAAAAERA                    LEDARRARHRARGELEKALALRDHAARLIAQVTCHACRQRSLAVMSMAAIDGHGASAV                    AREHLRGGGVGAGI</aaseq>|
+
* State Key Laboratory of Molecular Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.
DNA = <dnaseqindica>1618..2287#1..29#atggctggttgttgtagtcctaactcaaagtaagtaaaacatgagcgccactgtttgttcatgtgcaaacataatgcctgccagagctaatcagccattaatagcttgtaggagtagcattttagcatgcgagttactagcagctatttatggatcttaattctgtgaaaacttatcaggtggctgtagtaactgctatcgtcacgtaactttaaccacaaattacttttaaataattacttcctccaatccatattatcagttgttttgtcaaagtcaaacttcttcaaatctaaccaagtttataggaaaaagtagtaacattttcaacccaaaacaaatttgttacgaaaatatattcaattattgatttgatgaaactaatttggtgttgtaaatattactatatttatctataaacttagtcaaatttaaagcagtttgattttgatcaaagtcaaaacgatttataacctgaaacggagggagaacattataattaagaaaacttgtgtggttatattaatgatgatgtacacttcggtaatataacatatttttaagtagtatttatttttttccagaaaaattaccagaagtttaaacctgtatagtgacatagccaattatttaagaatgaagtatataatatctctatcaaatatagcaatcaagtacgtgataggataatcctgacctgcctagatttacagtaatagaattagaatgtgtgtttgatcccgtaatagaacggacactagtactacatgtagatgtcctagggagtgagatgatgtggacgaggcaaggtgcaaggtgacgaagcagaggtcgctaggtaggtaaagacaagctgctccattcctcggacccctggatccaccaccaaagtacaaccacgcgcggacggggcacatcaccagatcgcccggagctaagctatacacaggccaccatgtgcacccatccatcatccatgcacacacaacagcatcatctcctcctctgtttttttctctccaggacaagagcttcccactaggcgatcgctttaataattggcagtagctaagccacactctcttgtcactgaccagcccataaatataccggacgagcagcagcatcagcagcatatgcagcatgttttcccctgcagataccgatatgatcgttgcttcttccatatgtcgtcgtcgtcgtcgacgactggttttctagctcgatcaataatggcgtaagtgcaggcgccatcactagctagctgtgtgtgtagtatatgtgtacagtgctgctgttggttggtcccttggacggactggtcgcgcgtggccatttagtcagcaatggaacgtagctagcttccttgatgggtttaacgatggcatatggtggtccatcccatgggtttcatctggttgtctcatgctctcatcgatctgtcagtgtgtgtcttgttcgagatcgatgcgttgctttcgatcgatctacatgtacagatgatcaatcagtcgatcagatcgatcgccgtgtttttgttgtgtttggtgataagatggtggttaagtggtatgattagtgtgtgctaatggcggtggttgtgtgtgttggttgcagagtggagagcttcatagagcaccaggatgcgtgtaactctggacgtgtgcgcggtgaggtcgtgcccgtggccacgacgctgccggtcatccgtcccgcggcgctgcggcatcatcaccatcatccgccgccgccgccgcctgagctgcagctcctcccggcgtccaccacggcgccgttggccgccgcgttctcgtccaactccacgaccaccggctcctcctcccacgagcaacacgcgacgacgatgacaacgacgaagctgcagctctcaatcggccccgccgccgtcgtcgccgcggcgtccggcggcggcggcgcctgcgccgcggcggcaggaggggaggaggagcagcagcgggaagaggtgaggcgcgcgctggaggagaagaccgcggcggacgcggcgcgggagcgggcgcgcgaggaggccgcggcggcggagcgcgcgctggaggacgcccgccgcgcgcgccaccgggcgcgcggggagctcgagaaggcgctcgcgctgcgggaccacgcggcgcgcctgatcgcgcaggtgacctgccacgcgtgccggcagcgctcgctcgccgtgatgtccatggccgccatcgacggccacggcgcgtcggcggtggcgcgcgagcacctgaggggcggcggcgtcggcgccggcatctag</dnaseqindica>|
+
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056029.2 RefSeq:Os03g0237200]|
+
==References==
}}
+
<references>
[[Category:Genes]]
+
* <ref name="ref1">
[[Category:Japonica mRNA]]
+
Liu JM, Park SJ, Huang J, Lee EJ, Xuan YH, Je BI, Kumar V, Priatama RA, Raj K
[[Category:Oryza Sativa Japonica Group]]
+
V, Kim SH, Min MK, Cho JH, Kim TH, Chandran AK, Jung KH, Takatsuto S, Fujioka S,
[[Category:Japonica Genes]]
+
Han CD. Loose Plant Architecture1 (LPA1) determines lamina joint bending by
[[Category:Japonica Chromosome 3]]
+
suppressing auxin signalling that interacts with C-22-hydroxylated and 6-deoxo
[[Category:Chromosome 3]]
+
brassinosteroids in rice. J Exp Bot. 2016 Mar;67(6):1883-95. doi:
 +
10.1093/jxb/erw002. Epub 2016 Jan 29. PubMed PMID: 26826218; PubMed Central
 +
PMCID: PMC4783368.
 +
</ref>
 +
</references>
 +
 
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 3]]

Latest revision as of 14:47, 17 January 2018

The rice Os03g0237200 was reported as LPA1 in 2015 [1] by researchers from Korea and Japan.

Annotated Information

Function

  • Loose Plant Architecture1 (LPA1) determines lamina joint bending by suppressing auxin signalling that interacts with C-22-hydroxylated and 6-deoxo brassinosteroids in rice.

Phenotypic analysis

  • The researchers examined the mode of action of LPA1 on lamina bending by comparing the phenotypes among knockout, overexpression and repressor-fusion transgenic plants.
  • A strong synergic effect is detected between lpa1 and d2 (the defective mutant for catalysis of C-23-hydroxylated BRs) during IAA-mediated lamina inclination.

Expression

  • The Ubiquitin promoter was used to overexpress LPA1 cDNA. To construct a vector expressing repressor-fused LPA1, the C-terminus of LPA1 was fused with the 24 amino acid fragment containing a conserved ERF-associated amphiphilic repression (EAR) motif of a gene (LOC_Os02g01090) orthologous to Arabidopsis SUPERMAN (At3g23130).
  • RNA sequencing analysis and qRT-PCR indicate that LPA1 influences the expression of three OsPIN genes (OsPIN1a, OsPIN1c and OsPIN3a), which suggests that auxin flux might be an important factor in LPA1-mediated lamina inclination in rice.

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou, China;
  • Department of Biology - Plant Biology, University of Fribourg, Rue Albert-Gockel 3, CH-1700 Fribourg, Switzerland
  • State Key Laboratory of Plant Genomics, National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.
  • State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou, China
  • State Key Laboratory of Molecular Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.

References

  1. Liu JM, Park SJ, Huang J, Lee EJ, Xuan YH, Je BI, Kumar V, Priatama RA, Raj K V, Kim SH, Min MK, Cho JH, Kim TH, Chandran AK, Jung KH, Takatsuto S, Fujioka S, Han CD. Loose Plant Architecture1 (LPA1) determines lamina joint bending by suppressing auxin signalling that interacts with C-22-hydroxylated and 6-deoxo brassinosteroids in rice. J Exp Bot. 2016 Mar;67(6):1883-95. doi: 10.1093/jxb/erw002. Epub 2016 Jan 29. PubMed PMID: 26826218; PubMed Central PMCID: PMC4783368.


Structured Information