Difference between revisions of "Os03g0339900"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
−
Please input one-sentence summary here.
+
'''''OsCIPK10''''' is a member of '''CIPK genes''' (CIPKs,calcineurin B-like protein interacting protein kinases) in rice<ref name="ref1"/>.
−
 
 
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
−
Please input function information here.
+
*[[Os03g0634400|''OsCIPK7'']], ''OsCIPK10'', [[Os01g0759400|''OsCIPK12'']], and [[Os12g0113500|''OsCIPK14'']] showed a similar diurnal pattern to ''OsGI''<ref name="ref2"/>.
 +
 
 +
*Interestingly, five ''OsCIPK'' genes, [[Os01g0292200|''OsCIPK1'']], [[Os07g0678600|''OsCIPK2'']], [[Os03g0339900|''OsCIPK10'']], ''OsCIPK11'' and ''OsCIPK12'', were transcriptionally '''up-regulated''' after '''bacterial blight infection'''<ref name="ref1"/><ref name="ref3"/>.
 +
 
 +
*By the RT-PCR-based cDNA cloning approach, '''15''' CIPK genes were cloned from stress-treated seedlings of Nipponbare. Among them, '''10''' genes ([[Os07g0678600|''OsCIPK2'']], '[[Os01g0206700|''OsCIPK5'']], ''OsCIPK10'', ''OsCIPK11'', [[Os01g0759400|''OsCIPK12'']], [[Os12g0113500|''OsCIPK14'']], [[Os11g0113700|''OsCIPK15'']], [[Os05g0332300|''OsCIPK18'']], [[Os06g0543400|''OsCIPK25'']] and [[Os02g0161000|''OsCIPK26'']]) were '''intron-less''', and other '''five''' genes ([[Os01g0292200|''OsCIPK1'']], [[Os03g0319400|''OsCIPK3'']], [[Os03g0634400|''OsCIPK7'']], [[Os07g0150700|''OsCIPK23'']] and [[Os06g0606000|''OsCIPK24'']]) were '''intron-rich'''<ref name="ref3"/>.
 +
 
 +
*''OsCIPK10'' was '''probably''' involved in the '''early events of rice disease response'''. ''OsCIPK10'' could be upstream regulators in multiple stress-response pathways<ref name="ref3"/>.
 +
 
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0004672 GO:0004672],[http://amigo.geneontology.org/amigo/term/GO:0004674 GO:0004674], [http://amigo.geneontology.org/amigo/term/GO:0006468 GO:0006468], [http://amigo.geneontology.org/amigo/term/GO:0005524 GO:0005524], [http://amigo.geneontology.org/amigo/term/GO:0007165 GO:0007165]
  
 
===Expression===
 
===Expression===
−
Please input expression information here.
+
*''OsCIPK10'' was '''induced by salinity and drought stress'''<ref name="ref1"/>, it also '''induced by ABA and cold'''<ref name="ref3"/>.
 +
*''OsCIPK10'' showed vegetative organ-preferred expression. Interestingly, expression of ''OsCIPK10'' was antagonistic to that of [[OOs05g0332300|''OsCIPK18'']], suggesting the possibility of mutual regulation between them<ref name="ref2"/>.
 +
*''OsCIPK10'' showed '''down-regulation''' under '''drought''' stress<ref name="ref2"/>. Under the '''high salinity''' conditions, ''OsCIPK10'' was '''up-regulated''' in both '''roots''' and '''shoots'''<ref name="ref3"/>.
 +
 
 +
*During the '''cold''' treatment, the expressions of OsCIPK10 was '''up-regulated '''in '''leaves''' of treated plants. In the '''ABA-treated''' seedlings, ''OsCIPK10'' was transcriptionally induced in '''leaves'''. During '''BB infection''', ''OsCIPK10 was '''up regulated''' in '''leaves''' of treated plants, and moreover, ''OsCIPK10'' was highly expressed 12 h after inoculation with ''PXO99''<ref name="ref3"/>.
  
 
===Evolution===
 
===Evolution===
−
Please input evolution information here.
+
''OsCIPK10'' belongs to '''subgroup III''' of ''OsCIPK'' family<ref name="ref2"/>.
 +
 
 +
===Knowledge Extension===
 +
*Calcineurin B-like protein-interacting protein kinases(CIPKs) are a group of typical Ser/Thr protein kinases that mediate calcium signals. Some genes in the CIPK family of rice are involved in the responses to multiple abiotic stresses, whereas some genes of the family are responsive to specific stresses<ref name="ref1"/>.
 +
 
 +
*The calcineurin B-like protein–CBL-interacting protein kinase ('''CBL–CIPK''') signaling pathway in plants is a Ca<sup>2+</sup>-related pathway that responds strongly to both abiotic and biotic environmental stimuli. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells<ref name="ref4"/>.
  
−
You can also add sub-section(s) at will.
+
*As a plant-specific Ca<sup>2+</sup> sensor relaying pathway, the CBL–CIPK pathway has some crosstalk with other signaling pathways. In addition, research has shown that there is crosstalk between the CBL–CIPK pathway and the low-K<sup>+</sup> response pathway, the ABA signaling pathway, the nitrate sensing and signaling pathway, and others<ref name="ref4"/>.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
−
Please input related labs here.
+
*State Key Laboratory of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing 210095, China
 +
*College of Chemistry and Life Sciences, Zhejiang Normal University, Jinhua 321004, China
 +
*Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
 +
*Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea
 +
*National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement,
 +
Huazhong Agricultural University, Wuhan 430070, China
  
 
==References==
 
==References==
−
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
 +
</ref>
 +
* <ref name="ref2">
 +
Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
 +
</ref>
 +
* <ref name="ref3">
 +
CHEN X, GU Z, LIU F, et al. Molecular Analysis of Rice CIPKs Involved in Biotic and Abiotic Stress Responses[J]. Chinese Journal of Rice Science, 2010, 6: 003
 +
</ref>
 +
* <ref name="ref4">
 +
Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J].
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 09:43, 29 January 2015

OsCIPK10 is a member of CIPK genes (CIPKs,calcineurin B-like protein interacting protein kinases) in rice[1].

Annotated Information

Function

  • Interestingly, five OsCIPK genes, OsCIPK1, OsCIPK2, OsCIPK10, OsCIPK11 and OsCIPK12, were transcriptionally up-regulated after bacterial blight infection[1][3].
  • OsCIPK10 was probably involved in the early events of rice disease response. OsCIPK10 could be upstream regulators in multiple stress-response pathways[3].


GO assignment(s): GO:0004672,GO:0004674, GO:0006468, GO:0005524, GO:0007165

Expression

  • OsCIPK10 was induced by salinity and drought stress[1], it also induced by ABA and cold[3].
  • OsCIPK10 showed vegetative organ-preferred expression. Interestingly, expression of OsCIPK10 was antagonistic to that of OsCIPK18, suggesting the possibility of mutual regulation between them[2].
  • OsCIPK10 showed down-regulation under drought stress[2]. Under the high salinity conditions, OsCIPK10 was up-regulated in both roots and shoots[3].
  • During the cold treatment, the expressions of OsCIPK10 was up-regulated in leaves of treated plants. In the ABA-treated seedlings, OsCIPK10 was transcriptionally induced in leaves. During BB infection, OsCIPK10 was up regulated in leaves of treated plants, and moreover, OsCIPK10 was highly expressed 12 h after inoculation with PXO99[3].

Evolution

OsCIPK10 belongs to subgroup III of OsCIPK family[2].

Knowledge Extension

  • Calcineurin B-like protein-interacting protein kinases(CIPKs) are a group of typical Ser/Thr protein kinases that mediate calcium signals. Some genes in the CIPK family of rice are involved in the responses to multiple abiotic stresses, whereas some genes of the family are responsive to specific stresses[1].
  • The calcineurin B-like protein–CBL-interacting protein kinase (CBL–CIPK) signaling pathway in plants is a Ca2+-related pathway that responds strongly to both abiotic and biotic environmental stimuli. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells[4].
  • As a plant-specific Ca2+ sensor relaying pathway, the CBL–CIPK pathway has some crosstalk with other signaling pathways. In addition, research has shown that there is crosstalk between the CBL–CIPK pathway and the low-K+ response pathway, the ABA signaling pathway, the nitrate sensing and signaling pathway, and others[4].

Labs working on this gene

  • State Key Laboratory of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing 210095, China
  • College of Chemistry and Life Sciences, Zhejiang Normal University, Jinhua 321004, China
  • Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
  • Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea
  • National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement,

Huazhong Agricultural University, Wuhan 430070, China

References

  1. ↑ 1.0 1.1 1.2 1.3 Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
  2. ↑ 2.0 2.1 2.2 2.3 Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
  3. ↑ 3.0 3.1 3.2 3.3 3.4 3.5 CHEN X, GU Z, LIU F, et al. Molecular Analysis of Rice CIPKs Involved in Biotic and Abiotic Stress Responses[J]. Chinese Journal of Rice Science, 2010, 6: 003
  4. ↑ 4.0 4.1 Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J].

Structured Information

Gene Name

Os03g0339900

Description

Similar to Serine/threonine protein kinase

Version

NM_001056597.1 GI:115452922 GeneID:4332786

Length

4478 bp

Definition

Oryza sativa Japonica Group Os03g0339900, complete gene.

Source

Oryza sativa Japonica Group 

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:12682704..12687181

Sequence Coding Region

12684576..12685931

Expression

GEO Profiles:Os03g0339900

Genome Context

<gbrowseImage1> name=NC_008396:12682704..12687181 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:12682704..12687181 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtagaacaaaaggggaatattttgatgaagagatatgagataggaaaattacttgggcaaggaagtttcgctaaagtttaccatggccgtaatattaagaattcacaaagtgttgcaatcaaggtgattgacaaagaaaagatattgaaatgtgagcttatggatcaaataagaagagagatttcagtgatgaacctagtaagacatccgtgcattgttcaattgtatgaggtgatggctaccaaaactaagatatattttatcctagagtatgtgaaagggggagagttattcaacaaggttcgacgtggaagactaaaggaagaagttgcacggaagtactttcagcagttaattagtgctattgacttttgtcatagcagaggggtttatcatcgtgatctaaagccagaaaaccttcttcttgatgaaaatcgaaatttgaaaatctcagactttggtttgagtgcacttgcagaatgtaagagacaagatgggttgctccacacaacttgtggaactcctgcatatgttgctccagaagtgattaacagaaaaggatatgatggtgcaaaggctgacgtatgggcttgtggagtgattctttatgtactattggctggttatctcccatttcaagataaaaatgtgataaacatgtataagaagatatgcaaagcggaattcaaatggccaagttggttttcttctgatatccgaaagcttttgcgacgtattcttgatccaaaccctgcgacacggatctcagtttcagaaattatggaagatccttggtttagagtaggtcttaattcagatctacttaacaagaccataccaacagataaagttgataaagttgtgcatgttgacatggattcaacatttggtaatttaagcaacaatataaatgaaggaaaacaagaagcagaaaatcttactagcttgaatgcttttgatattatttctctttcatcaggatttgatctttctgctatgtttgaagatgaaaacagcaaagaggaatcaaaatttacatccactaacacagctacgacaatcaccaaaaagcttgaggatgttgcgaagaatttacgattaaaattcttgaagaaaaatggtggtttgttaaagatggaaggatcaaaacctggaaggaaaggtgtaatgtccatcaatgctgaaatatttcagatcacaccagattttcatttagtggaatttacgaagataaatggtgatacacttgagtatcaaaaggtcaaacaagagatgagaccagcactaaaggatattgtatgggcttggcaaggtgagcagccacaaccacaatcattgaacgaacagtcttaa</cdnaseq>

Protein Sequence

<aaseq>MVEQKGNILMKRYEIGKLLGQGSFAKVYHGRNIKNSQSVAIKVI DKEKILKCELMDQIRREISVMNLVRHPCIVQLYEVMATKTKIYFILEYVKGGELFNKV RRGRLKEEVARKYFQQLISAIDFCHSRGVYHRDLKPENLLLDENRNLKISDFGLSALA ECKRQDGLLHTTCGTPAYVAPEVINRKGYDGAKADVWACGVILYVLLAGYLPFQDKNV INMYKKICKAEFKWPSWFSSDIRKLLRRILDPNPATRISVSEIMEDPWFRVGLNSDLL NKTIPTDKVDKVVHVDMDSTFGNLSNNINEGKQEAENLTSLNAFDIISLSSGFDLSAM FEDENSKEESKFTSTNTATTITKKLEDVAKNLRLKFLKKNGGLLKMEGSKPGRKGVMS INAEIFQITPDFHLVEFTKINGDTLEYQKVKQEMRPALKDIVWAWQGEQPQPQSLNEQ S</aaseq>

Gene Sequence

<dnaseqindica>1251..2606#atcgtttttggtggctcctgattcgtttcctccgtctcactcctactcctcggctgcccccattcttctctggatatttttctttttcatcttctttgagttggagggcttgattttaggggggactgctcgatcggcagggttaattccgatctctttaaccttcccggatcagagccgggatcaggtaccgattctgccactcacatccgagttcttcttcgttttgatctgtttcttttttactcgtatgaagatggaagatttactaccctaggaagaactgtggtttagtgagcagttaattaggaatctaatccttggtcatgatgtagaacacggttacacgggtgtgctctgttactctgtagtagcagttctttcttagacttattaaaaggtttagtggcatgggttcgtcagtaacctttctttagagggttattaaacatgtattttgcttgtccttgggcatatgatttgaggactttgttgatttctatcttctgccggagtgagtggtgtttagttggtcccgtcatgattctgaactgacctagcgctaatatcctttcatttcatttataggattgttatactgttcctttttagaattttcttaggaagaatttcgttgattttttttttgtagaatgtagacatagtgacttttgtagaatctggctagcaccagacgaagagaatcatactatgtgggactctggaagaatttatccaaatgtttccttttgctttggaaggaaacagatttgctctttacattctcgtgaaaacaacaaaatattaacatacatggaaagatttcttttgttagttataatgcagtactattaattcactattcagtaatgtgtaccttaccatttatttcattttattggcagtattaggctttttgctagaagcacaaaacaaaaggaatgctggaagatgtgcttctatgatagagagctaccttgtgtgggaattggaaaggtagctcaaaatatttatgctttgtgtgctcttgatgatagtgaagtacgggtttatgcacagcaagtgctccttgtgcatttgcacgatggggctagatgtggcagttcaaccatcatgttagattaccatcttgttggggacggttgaaattatttttcatttattgcctctctcatctgatactccctcatcaatcatcatcactaagttacatgattagtgctttctgaatacataaggcatttgataagatggtagaacaaaaggggaatattttgatgaagagatatgagataggaaaattacttgggcaaggaagtttcgctaaagtttaccatggccgtaatattaagaattcacaaagtgttgcaatcaaggtgattgacaaagaaaagatattgaaatgtgagcttatggatcaaataagaagagagatttcagtgatgaacctagtaagacatccgtgcattgttcaattgtatgaggtgatggctaccaaaactaagatatattttatcctagagtatgtgaaagggggagagttattcaacaaggttcgacgtggaagactaaaggaagaagttgcacggaagtactttcagcagttaattagtgctattgacttttgtcatagcagaggggtttatcatcgtgatctaaagccagaaaaccttcttcttgatgaaaatcgaaatttgaaaatctcagactttggtttgagtgcacttgcagaatgtaagagacaagatgggttgctccacacaacttgtggaactcctgcatatgttgctccagaagtgattaacagaaaaggatatgatggtgcaaaggctgacgtatgggcttgtggagtgattctttatgtactattggctggttatctcccatttcaagataaaaatgtgataaacatgtataagaagatatgcaaagcggaattcaaatggccaagttggttttcttctgatatccgaaagcttttgcgacgtattcttgatccaaaccctgcgacacggatctcagtttcagaaattatggaagatccttggtttagagtaggtcttaattcagatctacttaacaagaccataccaacagataaagttgataaagttgtgcatgttgacatggattcaacatttggtaatttaagcaacaatataaatgaaggaaaacaagaagcagaaaatcttactagcttgaatgcttttgatattatttctctttcatcaggatttgatctttctgctatgtttgaagatgaaaacagcaaagaggaatcaaaatttacatccactaacacagctacgacaatcaccaaaaagcttgaggatgttgcgaagaatttacgattaaaattcttgaagaaaaatggtggtttgttaaagatggaaggatcaaaacctggaaggaaaggtgtaatgtccatcaatgctgaaatatttcagatcacaccagattttcatttagtggaatttacgaagataaatggtgatacacttgagtatcaaaaggtcaaacaagagatgagaccagcactaaaggatattgtatgggcttggcaaggtgagcagccacaaccacaatcattgaacgaacagtcttaatgttaaatattttgacaagtgaaatgacagtagagattgtggcaatgtgttgatgtgttgtatgtgctattagtaatcaataatgtacttttctaaaaaagtttgtcatttgatttttcattatcatgtgttcagtatgaaacgataattgtattgaccatttaattgaaaacatgttttattcactttgccatgtgttctaaaataagtatggaagtcactaaaataaaagcttgagtatttagagtttgggttatatagaaatcataggtgaacttttgtatcagtacaaattgtattctttttgtttgagtctaatctctttgctacaatattagctatagctgtaatgacactgacaaatatcatagtccgttcagtaatcatattttgaggaaatttttataaatctcctttggatggctaaagatgacctatggttttttttccttgggatatttcttttccattacttacattagaataaacctagacagtatgtctatattccaaataatatatgtatgggacaagttattaaccttggtgctgaaataattagaatggtgctaaattattgataatccacattttgctatggttgcttttaaattcaagctggcaagcataattcatgctgcaaatatatttatcccgaaataggtgatataatataatactacactacgctatacacaaaatctagttgtcagattggacaatcaccaacataaccaatgatttgtatgtttcattttgttccccctctttcaatcgatgttgtggccagccgtttgttccaatcttacaaactgatgctgcatttaactattgatttcactgagctaaactgatgcaaggctagacccataggcaaggaatgactattgaaatgtgattgattcatatgcaaggttgaagcttcatcgaaatgccaaacaaatactgaatgccaaacaatgggcgattcaagcagtctgatgtactacctccgtcctaaaataagtgcagtcgtagatatttgtgctcaacgtttgaccgtccgtcttatttaaaaaatttgtgaaaaatttgaaaatatttagtcacacataaagtactattcatgttttatcatctaatagcaataaaaatactaattataaaaaaaaataaataagacgaacggtcaaacgttgaacgtgaatagtgcaaaactgtacttattttgggacggagggagtattacggtacaccatttgtttcagcatttcattctgctagcgacgaggaacactctagaagtatctagaattttacagcttgctgaaattacaagctactaattccttcgaatcccggatccatctgtgtgttacagccactcgccaccttgattagtggcgggggcagaatgatttgggggatttaatgatatgcaagtcagctgaaaatatcaagcttttgatggtggtggttgctgcttagctaattgacaatacatttgttggtgctcaaaagttgcagcaaaagccaagaagaggcatgtgttgatgggtgctgcactggcccaggtcaggtgagctacagcaatcggaaaatcctcggttgctggctggaaagatttttgttgagctcgccctgttgtccatggctaaaaagatggttgcaatttcggttggctggagcaacttgcttcctgatgtatgcctcatagtataacctttgcttctccggtttgtacccaaagatattgtgtgcaggcaaaagcaaatgagagtagctggttagagtgtgtatggtttatcttaactgaatggtcatttttcgtcgagaaacttaaccacttgaaacctttcattaacgagactgaactcgacgttttcgggcttg</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0339900, RefSeq:Os03g0339900

Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0339900&oldid=184802"