Difference between revisions of "Os08g0559300"

From RiceWiki
Jump to: navigation, search
(References)
Line 6: Line 6:
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
The SPY gene is expressed throughout the plant and can be detected not only in all organs where the phenotypes of spy mutants have been observed but also in the roots<ref name="ref5" />.
 +
Analysis of Arabidopsis plants containing aSPY::GUS reporter gene reveals thatSPY is expressed throughout the life of the plant and in most plant organs examined. In addition to being expressed in all organs where phenotypes due to spy mutations have been reported, SPY::GUS is expressed in the root.  A secondSPY::GUS reporter gene lacking part of the SPY promoter was inactive, suggesting that sequences in the first exon and/or intron are required for detectable expression. Using both subcellular fractionation and visualization of a SPY-green fluorescent protein fusion protein that is able to rescue thespy mutant phenotype, the majority of SPY protein was shown to be present in the nucleus<ref name="ref6" />.  
  
 
===Evolution===
 
===Evolution===
Line 39: Line 40:
 
Thornton, T.M., Swain, S.M. and Olszewski, N.E.(1999) Gibberellin signal transduction presents…the SPY who O-GlcNAc’d me.Trends Plant Sci.4, 424–428.
 
Thornton, T.M., Swain, S.M. and Olszewski, N.E.(1999) Gibberellin signal transduction presents…the SPY who O-GlcNAc’d me.Trends Plant Sci.4, 424–428.
  
 +
<ref name="ref5">Qin, F., Kodaira, K. S., Maruyama, K., Mizoi, J., Tran, L. S. P., Fujita, Y., ... & Yamaguchi-Shinozaki, K. (2011). SPINDLY, a negative regulator of gibberellic acid signaling, is involved in the plant abiotic stress response. Plant physiology, 157(4), 1900-1913.
 +
 +
<ref name="ref6">Swain, S. M., Tseng, T. S., Thornton, T. M., Gopalraj, M., & Olszewski, N. E. (2002). SPINDLY is a nuclear-localized repressor of gibberellin signal transduction expressed throughout the plant. Plant physiology, 129(2), 605-615.
 
==Structured Information==
 
==Structured Information==
 
{{JaponicaGene|
 
{{JaponicaGene|

Revision as of 02:24, 23 May 2014

Please input one-sentence summary here.

Annotated Information

Function

SPINDLY(SPY) encodes an O-linked N-acetylglucosamine transferase that is considered to be a negative regulator of gibberellin (GA) signaling through an unknown mechanism(Jacobsen and Olszewski,1993; Jacobsenet al., 1996;Swain et al., 2001).Shimada et al(2006) isolated a rice SPINDLY homolog (OsSPY) and produced knockdown transgenic plants in which OsSPY expression was reduced by introducing its antisense or RNAi construct;they find that in knockdown plants, the enhanced elongation of lower internodes was correlated with decreased levels of OsSPY expression, similar to the spindly phenotype of Arabidopsis spy mutants,The suppression of OsSPY function in a GA‐insensitive mutant, gid2, also caused an increase in the phosphorylation of a rice DELLA protein, SLR1, but did not change the amount of SLR1.suggest that OsSPY functions as a negative factor in GA signaling in rice; OsSPY in GA signaling is not via changes in the amount or stability of SLR1, but probably involves control of the suppressive function of SLR1;and OsSPY may play roles both in GA signaling and in the brassinosteroid pathway.

Expression

The SPY gene is expressed throughout the plant and can be detected not only in all organs where the phenotypes of spy mutants have been observed but also in the roots[1]. Analysis of Arabidopsis plants containing aSPY::GUS reporter gene reveals thatSPY is expressed throughout the life of the plant and in most plant organs examined. In addition to being expressed in all organs where phenotypes due to spy mutations have been reported, SPY::GUS is expressed in the root. A secondSPY::GUS reporter gene lacking part of the SPY promoter was inactive, suggesting that sequences in the first exon and/or intron are required for detectable expression. Using both subcellular fractionation and visualization of a SPY-green fluorescent protein fusion protein that is able to rescue thespy mutant phenotype, the majority of SPY protein was shown to be present in the nucleus[2].

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

1.Bioscience and Biotechnology Center, Nagoya University, Chikusa, Nagoya, Aichi 464-8601, Japan

2.Field Production Science Center, University of Tokyo, Nishi-Tokyo, Tokyo 188-0002, Japan

3.RIKEN (The Institute of Physical and Chemical Research), Wako-shi, Saitama 351-0198, Japan

4.Department of Chemistry, Joetsu University of Education, Joetsu-shi, Niigata 943-8512, Japan

5.Science and Technology Research Institute,Chiang Mai University,Chiang Mai 50200,Thailand

6.Molecular Biology Laboratory,Department of Biology, Faculty of Science, Chiang Mai University,Chiang Mai 50200,Thailand

7.Plasma and Beam Physics Research Facility,Department of Physics and Materials Science,Faculty of Science,Chiang Mai University,Chiang Mai 50200

8.Thailand Center of Excellence in Physics,Commission on Higher Education, 328 Si Ayutthaya Road,Bangkok 10400,Thailand

References

Jacobsen, S.E. and Olszewski, N.E.(1993) Mutations at theS PINDLY locus of Arabidopsisalter gibberellin signal transduction.Plant Cell, 5, 887–896.

Jacobsen, S.E., Binkowski, K.A. and Olszewski, N.E.(1996) SPINDLY, a tetratricopeptide repeat protein involved in gibberellin signal transduction in Arabidopsis. Proc. Natl Acad. Sci. USA, 93, 9292–9296.

Swain, S.M., Tseng, T.-S. and Olszewski, N.E. (2001) Altered expression ofSPINDLYaffects gibberellin response and plant development.Plant Physiol.126, 1174–1185.

Thornton, T.M., Swain, S.M. and Olszewski, N.E.(1999) Gibberellin signal transduction presents…the SPY who O-GlcNAc’d me.Trends Plant Sci.4, 424–428.

<ref name="ref5">Qin, F., Kodaira, K. S., Maruyama, K., Mizoi, J., Tran, L. S. P., Fujita, Y., ... & Yamaguchi-Shinozaki, K. (2011). SPINDLY, a negative regulator of gibberellic acid signaling, is involved in the plant abiotic stress response. Plant physiology, 157(4), 1900-1913.

<ref name="ref6">Swain, S. M., Tseng, T. S., Thornton, T. M., Gopalraj, M., & Olszewski, N. E. (2002). SPINDLY is a nuclear-localized repressor of gibberellin signal transduction expressed throughout the plant. Plant physiology, 129(2), 605-615.

Structured Information

Gene Name

Os08g0559300

Description

Similar to Gibberellin action negative regulator SPY

Version

NM_001069036.1 GI:115477810 GeneID:4346315

Length

7732 bp

Definition

Oryza sativa Japonica Group Os08g0559300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:28079564..28087295

Sequence Coding Region

28080313..28080681,28081406..28081567,28081662..28081837,28081928..28082003,28082401..28082529
,28082610..28082729,28082819..28082885,28082979..28083062,28083263..28083357
,28083674..28083738,28083851..28084049,28084673..28084867,28085113..28085207
,28085306..28085441,28085512..28085729,28085976..28086103,28086395..28086864

Expression

GEO Profiles:Os08g0559300

Genome Context

<gbrowseImage1> name=NC_008401:28079564..28087295 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:28079564..28087295 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggcgaccggggatggactccagcgaagggagggagagcaatggcgttgttcctgaacgtaatggtggtgctgtccctgcaaaacagcagttggacgggaaggacaccttgcggtacgccaacatcctccgctcccgcaacaaatttgccgaagcactccagttgtacaataatgtccttgagaaggatgaagccaatgtggaggcccttattggcaaagggatttgcctccaggcacagagcctacctatgcaggccatcgagtgcttcaacgaggccgtcaggatcgacccagggaatgcatgtgctctcacttattgtgggatgatatacaaagatgagggtcacttagttgaagctgcagaggcttatcaaaaagctcgaaatgcagatccttcctacaaacctgctgcagagtttcttgctattgtgttgaccgatcttggaactagcttgaagcttgcaggtaatacagaggaggggattcaaaaatattgtgaagctttggaagttgacagccactatgcgcctgcttattacaaccttggtgtggtttactcggagatgatgcaatttgatttggctcttacttgttacgagaaagctgctttggagaggccattgtatgctgaagcttattgcaacatgggagttatttacaagaatcgtggagaattagaagcagcaattgcctgctacgagaggtgcttgactatttccccaaattttgagattgccaagaataacatggcaatagcactaaccgacttgggtacaaaggtaaaaattgagggtgacattaatcaaggtgtggcatattacaagaaagctctgttctacaattggcactacgctgatgccatgtataatcttggtgtcgcatatggtgaaatgttgaattttgagatggctattgttttttacgagcttgctctgcacttcaatcctcgctgtgcggaggcatgcaacaacctgggagtaatatacaaggacagggataatcttgacaaagctgttgaatgttatcaaatggccttgtcaattaagccaaatttctctcagtcattgaataaccttggagttgtctacactgtccagggaaagatggatgctgcttcaagcatgattcagaaggccatatttgcaaattccacgtatgctgaagcatataataacttgggtgttctttacagagatgcaggaagtattacttcagccgtacaagcttatgagaaatgccttcaaattgatcctgattcacgaaatgctggtcagaatcgtttgcttgcgttgaattatattgatgagggctttgacgacaagctttatcaagctcacagggagtggggaaaacgcttcctgaaattgtatccacagtatactagttgggataacccaaaagtcgctgatcgtcctctggtcattggctatgtgtctcctgattactttactcactctgtgtcatacttcattgaagctccccttgcacaccatgactactcaaattacaaggtggttgtgtattctggtgttgtgaaggcagatgccaagacccttcgattcaaggataaggtattaaaaaagggtgggttgtggagagatatatatggtattgatgaaaagaaggttgctagcttggtaagagaggacaaagtggatatacttgtggaacttactggtcatacggcaaataacaagttaggaacaatggcatgcaggcctgctcctattcaggttacatggattggctaccctaatacaacaggtctgccaacaattgactacagaataacagattcattggctgacccacctgatacaacccaaaagcatgttgaagagttggtgcgccttcctgaaagctttctttgttacagtccttccccagaagctgggccagtttgtcccactccagcaattttaaatggtttcatcacgtttgggagttttaataatctagcaaagattacaccaaaagtattgcaagtttgggccaaaattttgtgtgcagtccctaactcccgtcttgtggttaagtgtaagccattctgctgcgacagtattagacagaaattcctatcaacactagcagaattgggtttggagccgttacgagttgacttgctgccactcatccatctcaaccatgatcacatgcaagcatattccctaatggacataagcctggatacgtttccatatgctggaactactactacatgtgaatctctatacatgggggttccatgtgttactatggctggctcagtccatgctcataatgttggtgttagtctactcactaaagttgggctggggaggctggttgcgaagtctgagaatgaatatgttagcttagcattggatttagcggcagatgttactgccttgcaagaactgagaatgagcctccgagggctgatggcgaaatcaccagtgtgtgatggagagaatttcacacgtggtctggaatctgcatacagaaacatgtggcgcagatactgtgatggggatgcacctgccctcaggcggttggatctgttacaggaagagccatgctccaataacaataagcaagattttgatgacaatcaggtcgcaaagctcgcagatctgaaagcacagagagtggatgccgcggtagatggagacaagcaatcccagttaacagcgcatgctgcagtagtaggggaagttcagcaggccccaataatggtgaatggtgtgagttcacctgtctcttctgggaaagttgaagcaaatgggcacataagccggtga</cdnaseq>

Protein Sequence

<aaseq>MGRPGMDSSEGRESNGVVPERNGGAVPAKQQLDGKDTLRYANIL RSRNKFAEALQLYNNVLEKDEANVEALIGKGICLQAQSLPMQAIECFNEAVRIDPGNA CALTYCGMIYKDEGHLVEAAEAYQKARNADPSYKPAAEFLAIVLTDLGTSLKLAGNTE EGIQKYCEALEVDSHYAPAYYNLGVVYSEMMQFDLALTCYEKAALERPLYAEAYCNMG VIYKNRGELEAAIACYERCLTISPNFEIAKNNMAIALTDLGTKVKIEGDINQGVAYYK KALFYNWHYADAMYNLGVAYGEMLNFEMAIVFYELALHFNPRCAEACNNLGVIYKDRD NLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAASSMIQKAIFANSTYAEAYN NLGVLYRDAGSITSAVQAYEKCLQIDPDSRNAGQNRLLALNYIDEGFDDKLYQAHREW GKRFLKLYPQYTSWDNPKVADRPLVIGYVSPDYFTHSVSYFIEAPLAHHDYSNYKVVV YSGVVKADAKTLRFKDKVLKKGGLWRDIYGIDEKKVASLVREDKVDILVELTGHTANN KLGTMACRPAPIQVTWIGYPNTTGLPTIDYRITDSLADPPDTTQKHVEELVRLPESFL CYSPSPEAGPVCPTPAILNGFITFGSFNNLAKITPKVLQVWAKILCAVPNSRLVVKCK PFCCDSIRQKFLSTLAELGLEPLRVDLLPLIHLNHDHMQAYSLMDISLDTFPYAGTTT TCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLGRLVAKSENEYVSLALDLAADVTAL QELRMSLRGLMAKSPVCDGENFTRGLESAYRNMWRRYCDGDAPALRRLDLLQEEPCSN NNKQDFDDNQVAKLADLKAQRVDAAVDGDKQSQLTAHAAVVGEVQQAPIMVNGVSSPV SSGKVEANGHISR</aaseq>

Gene Sequence

<dnaseqindica>750..1118#1843..2004#2099..2274#2365..2440#2838..2966#3047..3166#3256..3322#3416..3499#3700..3794#4111..4175#4288..4486#5110..5304#5550..5644#5743..5878#5949..6166#6413..6540#6832..7301#aaagaagggaaaaaaaatacgaaaagcaaaaaggaataaacggagggggctaaacaccaaaattccccctctccttctccttcccctcctcccgaaaccctcgccgccgtcgctgtcgaaaccctcgctgctgctgctgccgcacggcgcggcggggtaccgggtccccctccctgcggcggcgcggaggggtaggtctcccccccctcgctgcggcgtggcggtggggggtgcggtgccggctgccgcgccatgatcttgcgccggtggactgcgcctatccaatgtgagctctcctcctacttccgccgcggcattagggttcttgcttcttgagctggaagagttctcttgcgttgcgaacgcctactgtttcctgcgaattcttagtgcttgttcttggattctttccgggggtgttcttaatctgttgtttgcaaaagttctttttttctttttttggctagggttttgaaatttgcaatcttggtgttcttttccctgagtttttactaaaaagctgcggcttttacgcaattcggtggtagtccaaagccgcgtcctttttttctagtctttacgcgcatttggctccaatttttctcctttttttagacgcgttttcttcacgctaatattcgcaactgaaatcttagacctaacgaaccattctaaaattgatgatcgttacattctttctgcagaaaaaaaaaagataaagatagaacaagtaggttactttccgtaccatggggcgaccggggatggactccagcgaagggagggagagcaatggcgttgttcctgaacgtaatggtggtgctgtccctgcaaaacagcagttggacgggaaggacaccttgcggtacgccaacatcctccgctcccgcaacaaatttgccgaagcactccagttgtacaataatgtccttgagaaggatgaagccaatgtggaggcccttattggcaaagggatttgcctccaggcacagagcctacctatgcaggccatcgagtgcttcaacgaggccgtcaggatcgacccagggaatgcatgtgctctcacttattgtgggatgatatacaaagatgagggtcacttagttgaagctgcagaggtatgcgtaagattcttcatgtggattccctgttcttactgttagcttattcgttattgtgaaatctgatagtttttctttttagtttgttgtcataaacactagaagtctcaaatgttgtatatgtggttctctgaaagcaaaatactcaaatgctgaagtaagtgcctcgcacagtcgcactccccaaaataccaggcaatgagacttgggacttaactgccaatttctgacttctgagggtactgcagacctatttttagcaccaagttatatcttgagtggtttgtgtccaagaactgtaactagaaaccaaaacaactagtttgataagttcttgatcaagcatactatgcaagagataaaactgtcgagataatcactcaagaattttccagcagaagattttttattatctccatgacatacttattagcaccgtaaaattttgtgcgtagctggtggatagaatgacatgtgaatgagctaaggctcagctagagctgcaaaaagagtaatacttttgccccttggagaatagtggtccctattaattggcagggttgtaaaaatcctaagttcctaaccaatctaacatataagatcaaaacagttggtcagtccaaaaattctctcggaaaagcttggaatttcgacattgtttctgtatttattatgtgatatatttatccataaatgttctgatggagagaaattgtaacaggcttatcaaaaagctcgaaatgcagatccttcctacaaacctgctgcagagtttcttgctattgtgttgaccgatcttggaactagcttgaagcttgcaggtaatacagaggaggggattcaaaaatattgtgaagctttggaagttgacagccactatgcggtaccatcaccagctataatttatatctagatctctattattttgtttttgttatccatttaagttttttaatgtgttcatctgattaatgtagcctgcttattacaaccttggtgtggtttactcggagatgatgcaatttgatttggctcttacttgttacgagaaagctgctttggagaggccattgtatgctgaagcttattgcaacatgggagttatttacaagaatcgtggagaattagaagcagcaattgcctgctacgagaggtaagctttattttttctgctcatacaaattatgctgattcccaaagtactgttgaaaactaatgttgacttatctttactgtatcccaggtgcttgactatttccccaaattttgagattgccaagaataacatggcaatagcactaaccgacttgggtacaaaggtgtggtcttgctaccttttgtttcaaccaaatcaacacattgcttcttgtggtgtcctgcatgtcaatcataatggttgccatcacttgcccatcatattagcagtcatgcgtgacaggcttgaactaagactagtgttgatttgaaaattgtctcaatcatgtgggttaatgaggaaacatcatgataactctatgttttttcgttgcttgtccgctcactttttactctgagcatagcaactctggcaatataattaattttgactaaccttagaatgaatcatatgaaatagacctttttaatttatactttggtatacctttaagaattgttaactctggcatttggtggtgatttttgtatttttctcttatcaattgacatttttcacaggtaaaaattgagggtgacattaatcaaggtgtggcatattacaagaaagctctgttctacaattggcactacgctgatgccatgtataatcttggtgtcgcatatggtgaaatgttgaattttgagatggtcagtcataagaaaaaaatctttaatattctgtacataatgtcctctcttttgctgacactcttttctgttttccaaaggctattgttttttacgagcttgctctgcacttcaatcctcgctgtgcggaggcatgcaacaacctgggagtaatatacaaggacagggataatcttgacaaagctgttgaatgttatcaagtaagtggaactaattatgcagtatgcaatatctgcagatagtcacaagtatcacaacagattattcattatcttctattctgttgtagatggccttgtcaattaagccaaatttctctcagtcattgaataaccttggagttgtctacactgtccaggcatgctcctctgctagtcttgcacaatttctattgggattggatgattgtatcatgttttagcttattgaatatgttgttcttcatatatagggaaagatggatgctgcttcaagcatgattcagaaggccatatttgcaaattccacgtatgctgaagcatataataacttgggtaatgtttaaccaaccaacatcatgagagcctcttaaattctgccatgtaatttgaaacagcattttccagctgagactcataacaactatataagcactaatcagtaattcatttcattgctttgcataattctctttttgatagctggaatgagactttaatacgtaactgacaatccatcactgctttcaccataggtgttctttacagagatgcaggaagtattacttcagccgtacaagcttatgagaaatgccttcaaattgatcctgattcacgaaatgctggtcaggtactttctttgtcctaagcttgctaattaaaacttgtgtaatctttctgtgttgcatggagaattaaatttatttaagcaggtacagctaataattatacttatccatttagtagcaaactgggaagcatataaatgtttcttccttgtataaatagacaaatacttgtctattgcatgttcataatttgttccaaccttgatgttgcttgcccacggtatctgttttgctgctttttaaaaaaaaatatatatttgtggaatagctatggtttatatttgtaacattcaacttacgatatagcttgttctgcagaatcgtttgcttgcgttgaattatattgatgagggctttgacgacaagctttatcaagctcacaggtcatttagcactttttcacaatatacagtcatatttatgttagattgttttttctgtttttatgtgttagaaattctcaactatatattcactgtattttatattttgcagggagtggggaaaacgcttcctgaaattgtatccacagtatactagttgggataacccaaaagtcgctgatcgtcctctggtcattggctatgtgtctcctgattactttactcactctgtgtcatacttcattgaagctccccttgcacaccatgactactcaaattacaaggtggttgtgtattctggtgttgtgaaggtagatatagccgttccttttcttgtctctattttcctgcattttcacattgtgtcccaaaaaacttgtttagactgtcttgcctcattaagatttaaaatatatatggaaataatttatgcaaaaatattccttttgaaaacagaaatggtagttcaatggtcaataggatagtgaactgtaattatttttcaagataggcctctagactatgtccagtttcaggattaccactttattattgcctagactgaaatgttttaaatagtgggctaagacatttagtggttagccttctcaaacagctatagctatagcggctaaattgtacataagagcaaatatttagctagacccttctcaaacagctatagccggagatttaaaatgcatatcctgaaaccccccaagaaagattatcccagtaacagcgaatatataattggaaatcatccaaggtggctgacaactcggggccatttatttgtgacatatcagttattttccaacttgcatgtttcactacttgtacaaagaaattaggcccaatttatctgcaatgtgttcgagtacctgttttaatcacagttcattcatgttttcttcaattgaaaattatttaggcagatgccaagacccttcgattcaaggataaggtattaaaaaagggtgggttgtggagagatatatatggtattgatgaaaagaaggttgctagcttggtaagagaggacaaagtggatatacttgtggaacttactggtcatacggcaaataacaagttaggaacaatggcatgcaggcctgctcctattcaggtacctttgtgcccatgattcataactgtcacgttacctaatttcagaactatttggacagaagtgatatcatcagatcattatgttctgaaaccagcttcttctgatcttgctaacatgattgcttccttttcactctagtcaatgaaactattcaagtgtctaataataaatgattatctgactattctactatgtgattagtgaactgacaggggcttcttttacttgaattgcctgcacaggttacatggattggctaccctaatacaacaggtctgccaacaattgactacagaataacagattcattggctgacccacctgatacaacccaaaagtaagacatctgcttttcttgcggtgatagctttctggcatgcacttttatacccacacatctagaacgtgacggtgacaattatgaattatctgcaggcatgttgaagagttggtgcgccttcctgaaagctttctttgttacagtccttccccagaagctgggccagtttgtcccactccagcaattttaaatggtttcatcacgtttgggagttttaataatctagcaaaggtgacacataaaacttgagtaatcagttcatttttactggatcactatttattgatttttcttttggcagattacaccaaaagtattgcaagtttgggccaaaattttgtgtgcagtccctaactcccgtcttgtggttaagtgtaagccattctgctgcgacagtattagacagaaattcctatcaacactagcagaattgggtttggagccgttacgagttgacttgctgccactcatccatctcaaccatgatcacatgcaagcatattccctaatggacataaggtcagttatttagatacttcctccgtttcatattataagactttctagcattgtccacattcatatagatgttgtgtctagatttattaacatctatgtgaatgtggacaatgctagaaagtcttataatatgaaacggagggagtacatcttttatcctatgtttaaacatgttatgtaaacgagtagatccattctactgcattgtatcttaaattgtctgaactttggttggttcctttgcagcctggatacgtttccatatgctggaactactactacatgtgaatctctatacatgggggttccatgtgttactatggctggctcagtccatgctcataatgttggtgttagtctactcactaaagttggtacgtgtctatttactctgtggtgtatgtagcaatagatcgaattgctgtacagttttattttcatgctatttgttgatcgacttgttttcttcttttgcatcgccatgtgaagactcggaaaaaaaatcactattgtgctgtctggttttgagttttgatacatataacttgatgattggagcaggaattctagctattgaatctgacctttctttacacagttgaatcaggtcgggtatatgttctccttgccgaattgttggttgacatttactgttattcttgcagggctggggaggctggttgcgaagtctgagaatgaatatgttagcttagcattggatttagcggcagatgttactgccttgcaagaactgagaatgagcctccgagggctgatggcgaaatcaccagtgtgtgatggagagaatttcacacgtggtctggaatctgcatacagaaacatgtggcgcagatactgtgatggggatgcacctgccctcaggcggttggatctgttacaggaagagccatgctccaataacaataagcaagattttgatgacaatcaggtcgcaaagctcgcagatctgaaagcacagagagtggatgccgcggtagatggagacaagcaatcccagttaacagcgcatgctgcagtagtaggggaagttcagcaggccccaataatggtgaatggtgtgagttcacctgtctcttctgggaaagttgaagcaaatgggcacataagccggtgaccaaggggagtcgagcatactccattgatgtgggaaacactgacccactgtagcttgagatgcaccattgctgtggtggacatttgttcttacagaattcgacgctttgcaggcctacactgggtgtctcatttgtctgacacccacaatggataagaaagaagagcacttctgtgccatccgacggtgatttctctggttacactttgacctttgtagcaaatgtaagattgatgggggatatgcttatagagtttgatttgtagaggtataccccctgtgtaggtttatgaacatgatggcttcagttgccatatgttagaagaaacagagaaagaggaggaagcccttgttgtaaatgcagaaaaaacagaactgaaaaactactagaatcaattgacggcggcatttcaacaggctgtgtcatgatg</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0559300, RefSeq:Os08g0559300

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref5
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref6