Difference between revisions of "Os12g0101600"
| Line 16: | Line 16: | ||
===Mutation=== | ===Mutation=== | ||
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C. | narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C. | ||
| + | ==Structured Information== | ||
| + | LOCUS NM_001073722 1508 bp mRNA linear PLN 08-JUN-2010 | ||
| + | DEFINITION Oryza sativa Japonica Group Os12g0597000 (Os12g0597000) mRNA, | ||
| + | complete cds. | ||
| + | ACCESSION NM_001073722 | ||
| + | VERSION NM_001073722.2 GI:297613475 | ||
| + | KEYWORDS RefSeq. | ||
| + | SOURCE Oryza sativa Japonica Group (Japanese rice) | ||
| + | ORGANISM Oryza sativa Japonica Group | ||
| + | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; | ||
| + | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP | ||
| + | clade; Ehrhartoideae; Oryzeae; Oryza. | ||
| + | REFERENCE 1 | ||
| + | AUTHORS Tanaka,T., Antonio,B.A., Kikuchi,S., Matsumoto,T., Nagamura,Y., | ||
| + | Numa,H., Sakai,H., Wu,J., Itoh,T., Sasaki,T., Aono,R., Fujii,Y., | ||
| + | Habara,T., Harada,E., Kanno,M., Kawahara,Y., Kawashima,H., | ||
| + | Kubooka,H., Matsuya,A., Nakaoka,H., Saichi,N., Sanbonmatsu,R., | ||
| + | Sato,Y., Shinso,Y., Suzuki,M., Takeda,J., Tanino,M., Todokoro,F., | ||
| + | Yamaguchi,K., Yamamoto,N., Yamasaki,C., Imanishi,T., Okido,T., | ||
| + | Tada,M., Ikeo,K., Tateno,Y., Gojobori,T., Lin,Y.C., Wei,F.J., | ||
| + | Hsing,Y.I., Zhao,Q., Han,B., Kramer,M.R., McCombie,R.W., | ||
| + | Lonsdale,D., O'Donovan,C.C., Whitfield,E.J., Apweiler,R., | ||
| + | Koyanagi,K.O., Khurana,J.P., Raghuvanshi,S., Singh,N.K., | ||
| + | Tyagi,A.K., Haberer,G., Fujisawa,M., Hosokawa,S., Ito,Y., Ikawa,H., | ||
| + | Shibata,M., Yamamoto,M., Bruskiewich,R.M., Hoen,D.R., Bureau,T.E., | ||
| + | Namiki,N., Ohyanagi,H., Sakai,Y., Nobushima,S., Sakata,K., | ||
| + | Barrero,R.A., Sato,Y., Souvorov,A., Smith-White,B., Tatusova,T., | ||
| + | An,S., An,G., OOta,S., Fuks,G., Fuks,G., Messing,J., Christie,K.R., | ||
| + | Lieberherr,D., Kim,H., Zuccolo,A., Wing,R.A., Nobuta,K., | ||
| + | Green,P.J., Lu,C., Meyers,B.C., Chaparro,C., Piegu,B., Panaud,O. | ||
| + | and Echeverria,M. | ||
| + | CONSRTM Rice Annotation Project | ||
| + | TITLE The Rice Annotation Project Database (RAP-DB): 2008 update | ||
| + | JOURNAL Nucleic Acids Res. 36 (DATABASE ISSUE), D1028-D1033 (2008) | ||
| + | PUBMED 18089549 | ||
| + | REFERENCE 2 | ||
| + | AUTHORS Itoh,T., Tanaka,T., Barrero,R.A., Yamasaki,C., Fujii,Y., | ||
| + | Hilton,P.B., Antonio,B.A., Aono,H., Apweiler,R., Bruskiewich,R., | ||
| + | Bureau,T., Burr,F., Costa de Oliveira,A., Fuks,G., Habara,T., | ||
| + | Haberer,G., Han,B., Harada,E., Hiraki,A.T., Hirochika,H., Hoen,D., | ||
| + | Hokari,H., Hosokawa,S., Hsing,Y.I., Ikawa,H., Ikeo,K., Imanishi,T., | ||
| + | Ito,Y., Jaiswal,P., Kanno,M., Kawahara,Y., Kawamura,T., | ||
| + | Kawashima,H., Khurana,J.P., Kikuchi,S., Komatsu,S., Koyanagi,K.O., | ||
| + | Kubooka,H., Lieberherr,D., Lin,Y.C., Lonsdale,D., Matsumoto,T., | ||
| + | Matsuya,A., McCombie,W.R., Messing,J., Miyao,A., Mulder,N., | ||
| + | Nagamura,Y., Nam,J., Namiki,N., Numa,H., Nurimoto,S., O'Donovan,C., | ||
| + | Ohyanagi,H., Okido,T., Oota,S., Osato,N., Palmer,L.E., Quetier,F., | ||
| + | Raghuvanshi,S., Saichi,N., Sakai,H., Sakai,Y., Sakata,K., | ||
| + | Sakurai,T., Sato,F., Sato,Y., Schoof,H., Seki,M., Shibata,M., | ||
| + | Shimizu,Y., Shinozaki,K., Shinso,Y., Singh,N.K., Smith-White,B., | ||
| + | Takeda,J., Tanino,M., Tatusova,T., Thongjuea,S., Todokoro,F., | ||
| + | Tsugane,M., Tyagi,A.K., Vanavichit,A., Wang,A., Wing,R.A., | ||
| + | Yamaguchi,K., Yamamoto,M., Yamamoto,N., Yu,Y., Zhang,H., Zhao,Q., | ||
| + | Higo,K., Burr,B., Gojobori,T. and Sasaki,T. | ||
| + | CONSRTM Rice Annotation Project | ||
| + | TITLE Curated genome annotation of Oryza sativa ssp. japonica and | ||
| + | comparative genome analysis with Arabidopsis thaliana | ||
| + | JOURNAL Genome Res. 17 (2), 175-183 (2007) | ||
| + | PUBMED 17210932 | ||
| + | REFERENCE 3 | ||
| + | AUTHORS Ohyanagi,H., Tanaka,T., Sakai,H., Shigemoto,Y., Yamaguchi,K., | ||
| + | Habara,T., Fujii,Y., Antonio,B.A., Nagamura,Y., Imanishi,T., | ||
| + | Ikeo,K., Itoh,T., Gojobori,T. and Sasaki,T. | ||
| + | TITLE The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa | ||
| + | ssp. japonica genome information | ||
| + | JOURNAL Nucleic Acids Res. 34 (DATABASE ISSUE), D741-D744 (2006) | ||
| + | PUBMED 16381971 | ||
| + | REFERENCE 4 | ||
| + | AUTHORS Matsumoto,T., Wu,J., Kanamori,H., Katayose,Y., Fujisawa,M., | ||
| + | Namiki,N., Mizuno,H., Yamamoto,K., Antonio,B.A., Baba,T., | ||
| + | Sakata,K., Nagamura,Y., Aoki,H., Arikawa,K., Arita,K., Bito,T., | ||
| + | Chiden,Y., Fujitsuka,N., Fukunaka,R., Hamada,M., Harada,C., | ||
| + | Hayashi,A., Hijishita,S., Honda,M., Hosokawa,S., Ichikawa,Y., | ||
| + | Idonuma,A., Iijima,M., Ikeda,M., Ikeno,M., Ito,K., Ito,S., Ito,T., | ||
| + | Ito,Y., Ito,Y., Iwabuchi,A., Kamiya,K., Karasawa,W., Kurita,K., | ||
| + | Katagiri,S., Kikuta,A., Kobayashi,H., Kobayashi,N., Machita,K., | ||
| + | Maehara,T., Masukawa,M., Mizubayashi,T., Mukai,Y., Nagasaki,H., | ||
| + | Nagata,Y., Naito,S., Nakashima,M., Nakama,Y., Nakamichi,Y., | ||
| + | Nakamura,M., Meguro,A., Negishi,M., Ohta,I., Ohta,T., Okamoto,M., | ||
| + | Ono,N., Saji,S., Sakaguchi,M., Sakai,K., Shibata,M., Shimokawa,T., | ||
| + | Song,J., Takazaki,Y., Terasawa,K., Tsugane,M., Tsuji,K., Ueda,S., | ||
| + | Waki,K., Yamagata,H., Yamamoto,M., Yamamoto,S., Yamane,H., | ||
| + | Yoshiki,S., Yoshihara,R., Yukawa,K., Zhong,H., Yano,M., Yuan,Q., | ||
| + | Ouyang,S., Liu,J., Jones,K.M., Gansberger,K., Moffat,K., Hill,J., | ||
| + | Bera,J., Fadrosh,D., Jin,S., Johri,S., Kim,M., Overton,L., | ||
| + | Reardon,M., Tsitrin,T., Vuong,H., Weaver,B., Ciecko,A., Tallon,L., | ||
| + | Jackson,J., Pai,G., Aken,S.V., Utterback,T., Reidmuller,S., | ||
| + | Feldblyum,T., Hsiao,J., Zismann,V., Iobst,S., de Vazeille,A.R., | ||
| + | Buell,C.R., Ying,K., Li,Y., Lu,T., Huang,Y., Zhao,Q., Feng,Q., | ||
| + | Zhang,L., Zhu,J., Weng,Q., Mu,J., Lu,Y., Fan,D., Liu,Y., Guan,J., | ||
| + | Zhang,Y., Yu,S., Liu,X., Zhang,Y., Hong,G., Han,B., Choisne,N., | ||
| + | Demange,N., Orjeda,G., Samain,S., Cattolico,L., Pelletier,E., | ||
| + | Couloux,A., Segurens,B., Wincker,P., D'Hont,A., Scarpelli,C., | ||
| + | Weissenbach,J., Salanoubat,M., Quetier,F., Yu,Y., Kim,H.R., | ||
| + | Rambo,T., Currie,J., Collura,K., Luo,M., Yang,T., Ammiraju,J.S.S., | ||
| + | Engler,F., Soderlund,C., Wing,R.A., Palmer,L.E., de la Bastide,M., | ||
| + | Spiegel,L., Nascimento,L., Zutavern,T., O'Shaughnessy,A., Dike,S., | ||
| + | Dedhia,N., Preston,R., Balija,V., McCombie,W.R., Chow,T., Chen,H., | ||
| + | Chung,M., Chen,C., Shaw,J., Wu,H., Hsiao,K., Chao,Y., Chu,M., | ||
| + | Cheng,C., Hour,A., Lee,P., Lin,S., Lin,Y., Liou,J., Liu,S., | ||
| + | Hsing,Y., Raghuvanshi,S., Mohanty,A., Bharti,A.K., Gaur,A., | ||
| + | Gupta,V., Kumar,D., Ravi,V., Vij,S., Kapur,A., Khurana,P., | ||
| + | Khurana,P., Khurana,J.P., Tyagi,A.K., Gaikwad,K., Singh,A., | ||
| + | Dalal,V., Srivastava,S., Dixit,A., Pal,A.K., Ghazi,I.A., Yadav,M., | ||
| + | Pandit,A., Bhargava,A., Sureshbabu,K., Batra,K., Sharma,T.R., | ||
| + | Mohapatra,T., Singh,N.K., Messing,J., Nelson,A.B., Fuks,G., | ||
| + | Kavchok,S., Keizer,G., Linton,E., Llaca,V., Song,R., Tanyolac,B., | ||
| + | Young,S., Ho-Il,K., Hahn,J.H., Sangsakoo,G., Vanavichit,A., de | ||
| + | Mattos,Luiz.A.T., Zimmer,P.D., Malone,G., Dellagostin,O., de | ||
| + | Oliveira,A.C., Bevan,M., Bancroft,I., Minx,P., Cordum,H., | ||
| + | Wilson,R., Cheng,Z., Jin,W., Jiang,J., Leong,S.A., Iwama,H., | ||
| + | Gojobori,T., Itoh,T., Niimura,Y., Fujii,Y., Habara,T., Sakai,H., | ||
| + | Sato,Y., Wilson,G., Kumar,K., McCouch,S., Juretic,N., Hoen,D., | ||
| + | Wright,S., Bruskiewich,R., Bureau,T., Miyao,A., Hirochika,H., | ||
| + | Nishikawa,T., Kadowaki,K., Sugiura,M., Burr,B. and Sasaki,T. | ||
| + | CONSRTM International Rice Genome Sequencing Project | ||
| + | TITLE The map-based sequence of the rice genome | ||
| + | JOURNAL Nature 436 (7052), 793-800 (2005) | ||
| + | PUBMED 16100779 | ||
| + | REFERENCE 5 | ||
| + | CONSRTM IRGSP(International Rice Genome Sequencing Project) | ||
| + | TITLE Oryza sativa nipponbare(GA3) genomic DNA, chromosome 12 | ||
| + | JOURNAL Unpublished | ||
| + | REFERENCE 6 | ||
| + | CONSRTM The Rice Annotation Project (RAP) | ||
| + | TITLE The Second Rice Annotation Project Meeting (RAP2) | ||
| + | JOURNAL Unpublished | ||
| + | REFERENCE 7 (bases 1 to 1508) | ||
| + | AUTHORS Sasaki,T. | ||
| + | TITLE Direct Submission | ||
| + | JOURNAL Submitted (25-OCT-2004) Contact:Takuji Sasaki National Institute of | ||
| + | Agrobiological Sciences, Rice Genome Research Program; Kannondai | ||
| + | 2-1-2, Tsukuba, Ibaraki 305-8602, Japan URL | ||
| + | :http://rgp.dna.affrc.go.jp/ | ||
| + | COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | ||
| + | NCBI review. This record is derived from an annotated genomic | ||
| + | sequence (NC_008405). | ||
| + | On Jun 7, 2010 this sequence version replaced gi:115489405. | ||
| + | The IRGSP pseudomolecules (Build 4.0). | ||
| + | The orientation of the sequence is the short arm to the long arm of | ||
| + | the chromosome. | ||
| + | Genoscope, Evry cedex, France, URL:http://www.genoscope.cns.fr/, | ||
| + | Tel:(33)0 1 60 87 25 00 Fax:(33)0 1 60 87 25 14 | ||
| + | |||
| + | The position of gaps in this pseudomolecule with unknown size is | ||
| + | assigned 100 Ns based on the guideline set by DDBJ/EMBL/GenBank. | ||
| + | |||
| + | This sequence entry was annotated by the Rice Annotation Project. | ||
| + | http://rapdb.lab.nig.ac.jp/ | ||
| + | FEATURES Location/Qualifiers | ||
| + | source 1..1508 | ||
| + | /organism="Oryza sativa Japonica Group" | ||
| + | /mol_type="mRNA" | ||
| + | /cultivar="Nipponbare" | ||
| + | /db_xref="taxon:39947" | ||
| + | /chromosome="12" | ||
| + | gene 1..1508 | ||
| + | /gene="Os12g0597000" | ||
| + | /db_xref="GeneID:4352701" | ||
| + | CDS 373..1050 | ||
| + | /gene="Os12g0597000" | ||
| + | /note="Similar to Calcineurin B-like protein 2 (SOS3-like | ||
| + | calcium binding protein 1); | ||
| + | contains InterPro domain(s): IPR002048, IPR001125; | ||
| + | has GO asignment(s): GO:0005509; | ||
| + | supported by AK111887" | ||
| + | /codon_start=1 | ||
| + | /product="hypothetical protein" | ||
| + | /protein_id="NP_001067190.1" | ||
| + | /db_xref="GI:115489406" | ||
| + | /db_xref="GeneID:4352701" | ||
| + | /translation="MVQCLDGVRQLLAVVFKCCDLELKQPRGLEDPQVLARETVFSVS | ||
| + | EVEALYELFKKISSAVIDDGLINKEEFQLALFKTSKKESLFADRVFDLFDTKHNGILG | ||
| + | FDEFARALSVFHPSAPLDEKIDFSFQLYDLKQQGYIERQEVKQMVVATLAESGMNLSD | ||
| + | EIIESIIDKTFEEADTKHDGRIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVF | ||
| + | HSQVDDT" | ||
| + | ORIGIN | ||
| + | 1 agacgcacgc gcacacgcat acgcatcgca gccagttcat cctcgattcc tcccccgaat | ||
| + | 61 ttccttcgcg atctcacccc gcgtgcccta gctagctatc gaatcccgtc acctcggcgg | ||
| + | 121 cggcggcgag atcggagctc cgggttaacc tcatccaccg cgaggcgtgg aacctctctc | ||
| + | 181 tctctcgctc tcaccacctg aggatcgaag atcgaaaccc ctggcaccgg ctcgggccgc | ||
| + | 241 ggaatgggcg gccgcggtga gtagctaggt ctgcggcggc ggagttgttg ttgttggtgg | ||
| + | 301 tggtggtggt ggaggaggag ttggcggcgg agggggcggg ggcgttggtg gtggtggtgg | ||
| + | 361 tgggagagta tcatggtgca gtgtctcgac ggggtgaggc agctgctggc ggtcgtgttc | ||
| + | 421 aagtgctgcg acctcgagct gaagcagccg cgggggctcg aggatcccca ggtcctcgcg | ||
| + | 481 agggagaccg tcttcagcgt gagcgaggtc gaggcgctgt acgagctctt caagaagata | ||
| + | 541 agcagtgctg tgattgatga cgggctgatt aacaaggagg agtttcagtt ggcgctgttc | ||
| + | 601 aagaccagca agaaggagag cctgttcgcc gaccgtgtat ttgatttgtt tgacacaaaa | ||
| + | 661 cacaatggaa ttttaggatt tgatgaattt gctcgtgcac tctcagtatt tcatccaagt | ||
| + | 721 gctccacttg atgagaagat tgacttttca ttccagttat atgatctcaa gcaacaaggc | ||
| + | 781 tatattgaga gacaagaggt taagcagatg gttgttgcta cacttgctga gtctggaatg | ||
| + | 841 aatctttctg atgaaattat agagagcata atcgataaga catttgagga ggcagacaca | ||
| + | 901 aagcatgatg gaagaattga taaagaagag tggcgcaatc tggttcttcg tcatccctct | ||
| + | 961 ttgctgaaga acatgactct ccagtacctc aaggacatca ccactacatt tccaagcttt | ||
| + | 1021 gtcttccatt cccaggtcga tgacacctga attcttggat ttgtttgaac tcaaaccatc | ||
| + | 1081 agaagaatgc tcatgccggt tcattaagaa ttttgatatt gggttgttgg attgggcaga | ||
| + | 1141 gactccagag ctctgtagga tgttgcatgt tcgatttgag aagttctcaa atctttaaat | ||
| + | 1201 tgatgtaact ttgtttcttt cgtttggaag tttagtgtgg ctggagactt tcggggagat | ||
| + | 1261 gttaaatttc tgtctgaatc cgtagatcct ttattctctt cccctctttt ctgtttttct | ||
| + | 1321 ggctagcaat cagaatatct tttctgtttt tttggctagc aatcagaata tcggatatag | ||
| + | 1381 ttttgtgaat ctttcatttt gcgtacaaaa taggaacctt caaaaaaatt gatcgtgctg | ||
| + | 1441 gaaaatgttc tgttggagtt tgcaaattgc aatgatcatg aaatgctctc cttttttgag | ||
| + | 1501 agtttgca | ||
Revision as of 03:24, 28 May 2014
Please cite: 李志涛 (2014) Gene: "Os12g0101600" in RiceWiki, available at http://ricewiki.big.ac.cn/index.php?title=Os12g0101600&action=edit&redlink=1
Contents
Annotated Information
Function
Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots. Please input function information here.
Expression
The ricenarrow leaf2andnarrow leaf3loci encode WUSCHELrelated homeobox 3A (OsWOX3A) and function in leaf, spikelet,tiller and lateral root development.nal2/3 mutation negatively affects both vegetative and reproductive organ development with a severe loss of grain yield. Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) athere
Mutation
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.
Structured Information
LOCUS NM_001073722 1508 bp mRNA linear PLN 08-JUN-2010 DEFINITION Oryza sativa Japonica Group Os12g0597000 (Os12g0597000) mRNA,
complete cds.
ACCESSION NM_001073722 VERSION NM_001073722.2 GI:297613475 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group (Japanese rice)
ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
REFERENCE 1
AUTHORS Tanaka,T., Antonio,B.A., Kikuchi,S., Matsumoto,T., Nagamura,Y.,
Numa,H., Sakai,H., Wu,J., Itoh,T., Sasaki,T., Aono,R., Fujii,Y.,
Habara,T., Harada,E., Kanno,M., Kawahara,Y., Kawashima,H.,
Kubooka,H., Matsuya,A., Nakaoka,H., Saichi,N., Sanbonmatsu,R.,
Sato,Y., Shinso,Y., Suzuki,M., Takeda,J., Tanino,M., Todokoro,F.,
Yamaguchi,K., Yamamoto,N., Yamasaki,C., Imanishi,T., Okido,T.,
Tada,M., Ikeo,K., Tateno,Y., Gojobori,T., Lin,Y.C., Wei,F.J.,
Hsing,Y.I., Zhao,Q., Han,B., Kramer,M.R., McCombie,R.W.,
Lonsdale,D., O'Donovan,C.C., Whitfield,E.J., Apweiler,R.,
Koyanagi,K.O., Khurana,J.P., Raghuvanshi,S., Singh,N.K.,
Tyagi,A.K., Haberer,G., Fujisawa,M., Hosokawa,S., Ito,Y., Ikawa,H.,
Shibata,M., Yamamoto,M., Bruskiewich,R.M., Hoen,D.R., Bureau,T.E.,
Namiki,N., Ohyanagi,H., Sakai,Y., Nobushima,S., Sakata,K.,
Barrero,R.A., Sato,Y., Souvorov,A., Smith-White,B., Tatusova,T.,
An,S., An,G., OOta,S., Fuks,G., Fuks,G., Messing,J., Christie,K.R.,
Lieberherr,D., Kim,H., Zuccolo,A., Wing,R.A., Nobuta,K.,
Green,P.J., Lu,C., Meyers,B.C., Chaparro,C., Piegu,B., Panaud,O.
and Echeverria,M.
CONSRTM Rice Annotation Project
TITLE The Rice Annotation Project Database (RAP-DB): 2008 update
JOURNAL Nucleic Acids Res. 36 (DATABASE ISSUE), D1028-D1033 (2008)
PUBMED 18089549
REFERENCE 2
AUTHORS Itoh,T., Tanaka,T., Barrero,R.A., Yamasaki,C., Fujii,Y.,
Hilton,P.B., Antonio,B.A., Aono,H., Apweiler,R., Bruskiewich,R.,
Bureau,T., Burr,F., Costa de Oliveira,A., Fuks,G., Habara,T.,
Haberer,G., Han,B., Harada,E., Hiraki,A.T., Hirochika,H., Hoen,D.,
Hokari,H., Hosokawa,S., Hsing,Y.I., Ikawa,H., Ikeo,K., Imanishi,T.,
Ito,Y., Jaiswal,P., Kanno,M., Kawahara,Y., Kawamura,T.,
Kawashima,H., Khurana,J.P., Kikuchi,S., Komatsu,S., Koyanagi,K.O.,
Kubooka,H., Lieberherr,D., Lin,Y.C., Lonsdale,D., Matsumoto,T.,
Matsuya,A., McCombie,W.R., Messing,J., Miyao,A., Mulder,N.,
Nagamura,Y., Nam,J., Namiki,N., Numa,H., Nurimoto,S., O'Donovan,C.,
Ohyanagi,H., Okido,T., Oota,S., Osato,N., Palmer,L.E., Quetier,F.,
Raghuvanshi,S., Saichi,N., Sakai,H., Sakai,Y., Sakata,K.,
Sakurai,T., Sato,F., Sato,Y., Schoof,H., Seki,M., Shibata,M.,
Shimizu,Y., Shinozaki,K., Shinso,Y., Singh,N.K., Smith-White,B.,
Takeda,J., Tanino,M., Tatusova,T., Thongjuea,S., Todokoro,F.,
Tsugane,M., Tyagi,A.K., Vanavichit,A., Wang,A., Wing,R.A.,
Yamaguchi,K., Yamamoto,M., Yamamoto,N., Yu,Y., Zhang,H., Zhao,Q.,
Higo,K., Burr,B., Gojobori,T. and Sasaki,T.
CONSRTM Rice Annotation Project
TITLE Curated genome annotation of Oryza sativa ssp. japonica and
comparative genome analysis with Arabidopsis thaliana
JOURNAL Genome Res. 17 (2), 175-183 (2007)
PUBMED 17210932
REFERENCE 3
AUTHORS Ohyanagi,H., Tanaka,T., Sakai,H., Shigemoto,Y., Yamaguchi,K.,
Habara,T., Fujii,Y., Antonio,B.A., Nagamura,Y., Imanishi,T.,
Ikeo,K., Itoh,T., Gojobori,T. and Sasaki,T.
TITLE The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa
ssp. japonica genome information
JOURNAL Nucleic Acids Res. 34 (DATABASE ISSUE), D741-D744 (2006)
PUBMED 16381971
REFERENCE 4
AUTHORS Matsumoto,T., Wu,J., Kanamori,H., Katayose,Y., Fujisawa,M.,
Namiki,N., Mizuno,H., Yamamoto,K., Antonio,B.A., Baba,T.,
Sakata,K., Nagamura,Y., Aoki,H., Arikawa,K., Arita,K., Bito,T.,
Chiden,Y., Fujitsuka,N., Fukunaka,R., Hamada,M., Harada,C.,
Hayashi,A., Hijishita,S., Honda,M., Hosokawa,S., Ichikawa,Y.,
Idonuma,A., Iijima,M., Ikeda,M., Ikeno,M., Ito,K., Ito,S., Ito,T.,
Ito,Y., Ito,Y., Iwabuchi,A., Kamiya,K., Karasawa,W., Kurita,K.,
Katagiri,S., Kikuta,A., Kobayashi,H., Kobayashi,N., Machita,K.,
Maehara,T., Masukawa,M., Mizubayashi,T., Mukai,Y., Nagasaki,H.,
Nagata,Y., Naito,S., Nakashima,M., Nakama,Y., Nakamichi,Y.,
Nakamura,M., Meguro,A., Negishi,M., Ohta,I., Ohta,T., Okamoto,M.,
Ono,N., Saji,S., Sakaguchi,M., Sakai,K., Shibata,M., Shimokawa,T.,
Song,J., Takazaki,Y., Terasawa,K., Tsugane,M., Tsuji,K., Ueda,S.,
Waki,K., Yamagata,H., Yamamoto,M., Yamamoto,S., Yamane,H.,
Yoshiki,S., Yoshihara,R., Yukawa,K., Zhong,H., Yano,M., Yuan,Q.,
Ouyang,S., Liu,J., Jones,K.M., Gansberger,K., Moffat,K., Hill,J.,
Bera,J., Fadrosh,D., Jin,S., Johri,S., Kim,M., Overton,L.,
Reardon,M., Tsitrin,T., Vuong,H., Weaver,B., Ciecko,A., Tallon,L.,
Jackson,J., Pai,G., Aken,S.V., Utterback,T., Reidmuller,S.,
Feldblyum,T., Hsiao,J., Zismann,V., Iobst,S., de Vazeille,A.R.,
Buell,C.R., Ying,K., Li,Y., Lu,T., Huang,Y., Zhao,Q., Feng,Q.,
Zhang,L., Zhu,J., Weng,Q., Mu,J., Lu,Y., Fan,D., Liu,Y., Guan,J.,
Zhang,Y., Yu,S., Liu,X., Zhang,Y., Hong,G., Han,B., Choisne,N.,
Demange,N., Orjeda,G., Samain,S., Cattolico,L., Pelletier,E.,
Couloux,A., Segurens,B., Wincker,P., D'Hont,A., Scarpelli,C.,
Weissenbach,J., Salanoubat,M., Quetier,F., Yu,Y., Kim,H.R.,
Rambo,T., Currie,J., Collura,K., Luo,M., Yang,T., Ammiraju,J.S.S.,
Engler,F., Soderlund,C., Wing,R.A., Palmer,L.E., de la Bastide,M.,
Spiegel,L., Nascimento,L., Zutavern,T., O'Shaughnessy,A., Dike,S.,
Dedhia,N., Preston,R., Balija,V., McCombie,W.R., Chow,T., Chen,H.,
Chung,M., Chen,C., Shaw,J., Wu,H., Hsiao,K., Chao,Y., Chu,M.,
Cheng,C., Hour,A., Lee,P., Lin,S., Lin,Y., Liou,J., Liu,S.,
Hsing,Y., Raghuvanshi,S., Mohanty,A., Bharti,A.K., Gaur,A.,
Gupta,V., Kumar,D., Ravi,V., Vij,S., Kapur,A., Khurana,P.,
Khurana,P., Khurana,J.P., Tyagi,A.K., Gaikwad,K., Singh,A.,
Dalal,V., Srivastava,S., Dixit,A., Pal,A.K., Ghazi,I.A., Yadav,M.,
Pandit,A., Bhargava,A., Sureshbabu,K., Batra,K., Sharma,T.R.,
Mohapatra,T., Singh,N.K., Messing,J., Nelson,A.B., Fuks,G.,
Kavchok,S., Keizer,G., Linton,E., Llaca,V., Song,R., Tanyolac,B.,
Young,S., Ho-Il,K., Hahn,J.H., Sangsakoo,G., Vanavichit,A., de
Mattos,Luiz.A.T., Zimmer,P.D., Malone,G., Dellagostin,O., de
Oliveira,A.C., Bevan,M., Bancroft,I., Minx,P., Cordum,H.,
Wilson,R., Cheng,Z., Jin,W., Jiang,J., Leong,S.A., Iwama,H.,
Gojobori,T., Itoh,T., Niimura,Y., Fujii,Y., Habara,T., Sakai,H.,
Sato,Y., Wilson,G., Kumar,K., McCouch,S., Juretic,N., Hoen,D.,
Wright,S., Bruskiewich,R., Bureau,T., Miyao,A., Hirochika,H.,
Nishikawa,T., Kadowaki,K., Sugiura,M., Burr,B. and Sasaki,T.
CONSRTM International Rice Genome Sequencing Project
TITLE The map-based sequence of the rice genome
JOURNAL Nature 436 (7052), 793-800 (2005)
PUBMED 16100779
REFERENCE 5
CONSRTM IRGSP(International Rice Genome Sequencing Project) TITLE Oryza sativa nipponbare(GA3) genomic DNA, chromosome 12 JOURNAL Unpublished
REFERENCE 6
CONSRTM The Rice Annotation Project (RAP) TITLE The Second Rice Annotation Project Meeting (RAP2) JOURNAL Unpublished
REFERENCE 7 (bases 1 to 1508)
AUTHORS Sasaki,T.
TITLE Direct Submission
JOURNAL Submitted (25-OCT-2004) Contact:Takuji Sasaki National Institute of
Agrobiological Sciences, Rice Genome Research Program; Kannondai
2-1-2, Tsukuba, Ibaraki 305-8602, Japan URL
:http://rgp.dna.affrc.go.jp/
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NC_008405).
On Jun 7, 2010 this sequence version replaced gi:115489405.
The IRGSP pseudomolecules (Build 4.0).
The orientation of the sequence is the short arm to the long arm of
the chromosome.
Genoscope, Evry cedex, France, URL:http://www.genoscope.cns.fr/,
Tel:(33)0 1 60 87 25 00 Fax:(33)0 1 60 87 25 14
The position of gaps in this pseudomolecule with unknown size is
assigned 100 Ns based on the guideline set by DDBJ/EMBL/GenBank.
This sequence entry was annotated by the Rice Annotation Project.
http://rapdb.lab.nig.ac.jp/
FEATURES Location/Qualifiers
source 1..1508
/organism="Oryza sativa Japonica Group"
/mol_type="mRNA"
/cultivar="Nipponbare"
/db_xref="taxon:39947"
/chromosome="12"
gene 1..1508
/gene="Os12g0597000"
/db_xref="GeneID:4352701"
CDS 373..1050
/gene="Os12g0597000"
/note="Similar to Calcineurin B-like protein 2 (SOS3-like
calcium binding protein 1);
contains InterPro domain(s): IPR002048, IPR001125;
has GO asignment(s): GO:0005509;
supported by AK111887"
/codon_start=1
/product="hypothetical protein"
/protein_id="NP_001067190.1"
/db_xref="GI:115489406"
/db_xref="GeneID:4352701"
/translation="MVQCLDGVRQLLAVVFKCCDLELKQPRGLEDPQVLARETVFSVS
EVEALYELFKKISSAVIDDGLINKEEFQLALFKTSKKESLFADRVFDLFDTKHNGILG
FDEFARALSVFHPSAPLDEKIDFSFQLYDLKQQGYIERQEVKQMVVATLAESGMNLSD
EIIESIIDKTFEEADTKHDGRIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVF
HSQVDDT"
ORIGIN
1 agacgcacgc gcacacgcat acgcatcgca gccagttcat cctcgattcc tcccccgaat
61 ttccttcgcg atctcacccc gcgtgcccta gctagctatc gaatcccgtc acctcggcgg
121 cggcggcgag atcggagctc cgggttaacc tcatccaccg cgaggcgtgg aacctctctc
181 tctctcgctc tcaccacctg aggatcgaag atcgaaaccc ctggcaccgg ctcgggccgc
241 ggaatgggcg gccgcggtga gtagctaggt ctgcggcggc ggagttgttg ttgttggtgg
301 tggtggtggt ggaggaggag ttggcggcgg agggggcggg ggcgttggtg gtggtggtgg
361 tgggagagta tcatggtgca gtgtctcgac ggggtgaggc agctgctggc ggtcgtgttc
421 aagtgctgcg acctcgagct gaagcagccg cgggggctcg aggatcccca ggtcctcgcg
481 agggagaccg tcttcagcgt gagcgaggtc gaggcgctgt acgagctctt caagaagata
541 agcagtgctg tgattgatga cgggctgatt aacaaggagg agtttcagtt ggcgctgttc
601 aagaccagca agaaggagag cctgttcgcc gaccgtgtat ttgatttgtt tgacacaaaa
661 cacaatggaa ttttaggatt tgatgaattt gctcgtgcac tctcagtatt tcatccaagt
721 gctccacttg atgagaagat tgacttttca ttccagttat atgatctcaa gcaacaaggc
781 tatattgaga gacaagaggt taagcagatg gttgttgcta cacttgctga gtctggaatg
841 aatctttctg atgaaattat agagagcata atcgataaga catttgagga ggcagacaca
901 aagcatgatg gaagaattga taaagaagag tggcgcaatc tggttcttcg tcatccctct
961 ttgctgaaga acatgactct ccagtacctc aaggacatca ccactacatt tccaagcttt
1021 gtcttccatt cccaggtcga tgacacctga attcttggat ttgtttgaac tcaaaccatc
1081 agaagaatgc tcatgccggt tcattaagaa ttttgatatt gggttgttgg attgggcaga
1141 gactccagag ctctgtagga tgttgcatgt tcgatttgag aagttctcaa atctttaaat
1201 tgatgtaact ttgtttcttt cgtttggaag tttagtgtgg ctggagactt tcggggagat
1261 gttaaatttc tgtctgaatc cgtagatcct ttattctctt cccctctttt ctgtttttct
1321 ggctagcaat cagaatatct tttctgtttt tttggctagc aatcagaata tcggatatag
1381 ttttgtgaat ctttcatttt gcgtacaaaa taggaacctt caaaaaaatt gatcgtgctg
1441 gaaaatgttc tgttggagtt tgcaaattgc aatgatcatg aaatgctctc cttttttgag
1501 agtttgca