Difference between revisions of "Os12g0101600"

From RiceWiki
Jump to: navigation, search
(→‎Structured Information)
Line 17: Line 17:
 
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.
 
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.
 
==Structured Information==
 
==Structured Information==
−
LOCUS       NM_001073722            1508 bp    mRNA    linear  PLN 08-JUN-2010
+
LOCUS = NM_001073722            1508 bp    mRNA    linear  PLN 08-JUN-2010
−
DEFINITION Oryza sativa Japonica Group Os12g0597000 (Os12g0597000) mRNA,
+
DEFINITION = Oryza sativa Japonica Group Os12g0597000 (Os12g0597000) mRNA,
−
             complete cds.
+
             complete cds.|
−
ACCESSION   NM_001073722
+
ACCESSION = NM_001073722|
−
VERSION     NM_001073722.2  GI:297613475
+
VERSION = NM_001073722.2  GI:297613475|
−
KEYWORDS   RefSeq.
+
KEYWORDS = RefSeq.|
−
SOURCE     Oryza sativa Japonica Group (Japanese rice)
+
SOURCE = Oryza sativa Japonica Group (Japanese rice)|
−
   ORGANISM Oryza sativa Japonica Group
+
   ORGANISM = Oryza sativa Japonica Group
 
             Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
             Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
             Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
             Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
−
             clade; Ehrhartoideae; Oryzeae; Oryza.
+
             clade; Ehrhartoideae; Oryzeae; Oryza.|
−
REFERENCE  1
+
 
−
  AUTHORS  Tanaka,T., Antonio,B.A., Kikuchi,S., Matsumoto,T., Nagamura,Y.,
+
ORIGIN = 1 agacgcacgc gcacacgcat acgcatcgca gccagttcat cctcgattcc tcccccgaat
−
            Numa,H., Sakai,H., Wu,J., Itoh,T., Sasaki,T., Aono,R., Fujii,Y.,
 
−
            Habara,T., Harada,E., Kanno,M., Kawahara,Y., Kawashima,H.,
 
−
            Kubooka,H., Matsuya,A., Nakaoka,H., Saichi,N., Sanbonmatsu,R.,
 
−
            Sato,Y., Shinso,Y., Suzuki,M., Takeda,J., Tanino,M., Todokoro,F.,
 
−
            Yamaguchi,K., Yamamoto,N., Yamasaki,C., Imanishi,T., Okido,T.,
 
−
            Tada,M., Ikeo,K., Tateno,Y., Gojobori,T., Lin,Y.C., Wei,F.J.,
 
−
            Hsing,Y.I., Zhao,Q., Han,B., Kramer,M.R., McCombie,R.W.,
 
−
            Lonsdale,D., O'Donovan,C.C., Whitfield,E.J., Apweiler,R.,
 
−
            Koyanagi,K.O., Khurana,J.P., Raghuvanshi,S., Singh,N.K.,
 
−
            Tyagi,A.K., Haberer,G., Fujisawa,M., Hosokawa,S., Ito,Y., Ikawa,H.,
 
−
            Shibata,M., Yamamoto,M., Bruskiewich,R.M., Hoen,D.R., Bureau,T.E.,
 
−
            Namiki,N., Ohyanagi,H., Sakai,Y., Nobushima,S., Sakata,K.,
 
−
            Barrero,R.A., Sato,Y., Souvorov,A., Smith-White,B., Tatusova,T.,
 
−
            An,S., An,G., OOta,S., Fuks,G., Fuks,G., Messing,J., Christie,K.R.,
 
−
            Lieberherr,D., Kim,H., Zuccolo,A., Wing,R.A., Nobuta,K.,
 
−
            Green,P.J., Lu,C., Meyers,B.C., Chaparro,C., Piegu,B., Panaud,O.
 
−
            and Echeverria,M.
 
−
  CONSRTM  Rice Annotation Project
 
−
  TITLE    The Rice Annotation Project Database (RAP-DB): 2008 update
 
−
  JOURNAL  Nucleic Acids Res. 36 (DATABASE ISSUE), D1028-D1033 (2008)
 
−
  PUBMED  18089549
 
−
REFERENCE  2
 
−
  AUTHORS  Itoh,T., Tanaka,T., Barrero,R.A., Yamasaki,C., Fujii,Y.,
 
−
            Hilton,P.B., Antonio,B.A., Aono,H., Apweiler,R., Bruskiewich,R.,
 
−
            Bureau,T., Burr,F., Costa de Oliveira,A., Fuks,G., Habara,T.,
 
−
            Haberer,G., Han,B., Harada,E., Hiraki,A.T., Hirochika,H., Hoen,D.,
 
−
            Hokari,H., Hosokawa,S., Hsing,Y.I., Ikawa,H., Ikeo,K., Imanishi,T.,
 
−
            Ito,Y., Jaiswal,P., Kanno,M., Kawahara,Y., Kawamura,T.,
 
−
            Kawashima,H., Khurana,J.P., Kikuchi,S., Komatsu,S., Koyanagi,K.O.,
 
−
            Kubooka,H., Lieberherr,D., Lin,Y.C., Lonsdale,D., Matsumoto,T.,
 
−
            Matsuya,A., McCombie,W.R., Messing,J., Miyao,A., Mulder,N.,
 
−
            Nagamura,Y., Nam,J., Namiki,N., Numa,H., Nurimoto,S., O'Donovan,C.,
 
−
            Ohyanagi,H., Okido,T., Oota,S., Osato,N., Palmer,L.E., Quetier,F.,
 
−
            Raghuvanshi,S., Saichi,N., Sakai,H., Sakai,Y., Sakata,K.,
 
−
            Sakurai,T., Sato,F., Sato,Y., Schoof,H., Seki,M., Shibata,M.,
 
−
            Shimizu,Y., Shinozaki,K., Shinso,Y., Singh,N.K., Smith-White,B.,
 
−
            Takeda,J., Tanino,M., Tatusova,T., Thongjuea,S., Todokoro,F.,
 
−
            Tsugane,M., Tyagi,A.K., Vanavichit,A., Wang,A., Wing,R.A.,
 
−
            Yamaguchi,K., Yamamoto,M., Yamamoto,N., Yu,Y., Zhang,H., Zhao,Q.,
 
−
            Higo,K., Burr,B., Gojobori,T. and Sasaki,T.
 
−
  CONSRTM  Rice Annotation Project
 
−
  TITLE    Curated genome annotation of Oryza sativa ssp. japonica and
 
−
            comparative genome analysis with Arabidopsis thaliana
 
−
  JOURNAL  Genome Res. 17 (2), 175-183 (2007)
 
−
  PUBMED  17210932
 
−
REFERENCE  3
 
−
  AUTHORS  Ohyanagi,H., Tanaka,T., Sakai,H., Shigemoto,Y., Yamaguchi,K.,
 
−
            Habara,T., Fujii,Y., Antonio,B.A., Nagamura,Y., Imanishi,T.,
 
−
            Ikeo,K., Itoh,T., Gojobori,T. and Sasaki,T.
 
−
  TITLE    The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa
 
−
            ssp. japonica genome information
 
−
  JOURNAL  Nucleic Acids Res. 34 (DATABASE ISSUE), D741-D744 (2006)
 
−
  PUBMED  16381971
 
−
REFERENCE  4
 
−
  AUTHORS  Matsumoto,T., Wu,J., Kanamori,H., Katayose,Y., Fujisawa,M.,
 
−
            Namiki,N., Mizuno,H., Yamamoto,K., Antonio,B.A., Baba,T.,
 
−
            Sakata,K., Nagamura,Y., Aoki,H., Arikawa,K., Arita,K., Bito,T.,
 
−
            Chiden,Y., Fujitsuka,N., Fukunaka,R., Hamada,M., Harada,C.,
 
−
            Hayashi,A., Hijishita,S., Honda,M., Hosokawa,S., Ichikawa,Y.,
 
−
            Idonuma,A., Iijima,M., Ikeda,M., Ikeno,M., Ito,K., Ito,S., Ito,T.,
 
−
            Ito,Y., Ito,Y., Iwabuchi,A., Kamiya,K., Karasawa,W., Kurita,K.,
 
−
            Katagiri,S., Kikuta,A., Kobayashi,H., Kobayashi,N., Machita,K.,
 
−
            Maehara,T., Masukawa,M., Mizubayashi,T., Mukai,Y., Nagasaki,H.,
 
−
            Nagata,Y., Naito,S., Nakashima,M., Nakama,Y., Nakamichi,Y.,
 
−
            Nakamura,M., Meguro,A., Negishi,M., Ohta,I., Ohta,T., Okamoto,M.,
 
−
            Ono,N., Saji,S., Sakaguchi,M., Sakai,K., Shibata,M., Shimokawa,T.,
 
−
            Song,J., Takazaki,Y., Terasawa,K., Tsugane,M., Tsuji,K., Ueda,S.,
 
−
            Waki,K., Yamagata,H., Yamamoto,M., Yamamoto,S., Yamane,H.,
 
−
            Yoshiki,S., Yoshihara,R., Yukawa,K., Zhong,H., Yano,M., Yuan,Q.,
 
−
            Ouyang,S., Liu,J., Jones,K.M., Gansberger,K., Moffat,K., Hill,J.,
 
−
            Bera,J., Fadrosh,D., Jin,S., Johri,S., Kim,M., Overton,L.,
 
−
            Reardon,M., Tsitrin,T., Vuong,H., Weaver,B., Ciecko,A., Tallon,L.,
 
−
            Jackson,J., Pai,G., Aken,S.V., Utterback,T., Reidmuller,S.,
 
−
            Feldblyum,T., Hsiao,J., Zismann,V., Iobst,S., de Vazeille,A.R.,
 
−
            Buell,C.R., Ying,K., Li,Y., Lu,T., Huang,Y., Zhao,Q., Feng,Q.,
 
−
            Zhang,L., Zhu,J., Weng,Q., Mu,J., Lu,Y., Fan,D., Liu,Y., Guan,J.,
 
−
            Zhang,Y., Yu,S., Liu,X., Zhang,Y., Hong,G., Han,B., Choisne,N.,
 
−
            Demange,N., Orjeda,G., Samain,S., Cattolico,L., Pelletier,E.,
 
−
            Couloux,A., Segurens,B., Wincker,P., D'Hont,A., Scarpelli,C.,
 
−
            Weissenbach,J., Salanoubat,M., Quetier,F., Yu,Y., Kim,H.R.,
 
−
            Rambo,T., Currie,J., Collura,K., Luo,M., Yang,T., Ammiraju,J.S.S.,
 
−
            Engler,F., Soderlund,C., Wing,R.A., Palmer,L.E., de la Bastide,M.,
 
−
            Spiegel,L., Nascimento,L., Zutavern,T., O'Shaughnessy,A., Dike,S.,
 
−
            Dedhia,N., Preston,R., Balija,V., McCombie,W.R., Chow,T., Chen,H.,
 
−
            Chung,M., Chen,C., Shaw,J., Wu,H., Hsiao,K., Chao,Y., Chu,M.,
 
−
            Cheng,C., Hour,A., Lee,P., Lin,S., Lin,Y., Liou,J., Liu,S.,
 
−
            Hsing,Y., Raghuvanshi,S., Mohanty,A., Bharti,A.K., Gaur,A.,
 
−
            Gupta,V., Kumar,D., Ravi,V., Vij,S., Kapur,A., Khurana,P.,
 
−
            Khurana,P., Khurana,J.P., Tyagi,A.K., Gaikwad,K., Singh,A.,
 
−
            Dalal,V., Srivastava,S., Dixit,A., Pal,A.K., Ghazi,I.A., Yadav,M.,
 
−
            Pandit,A., Bhargava,A., Sureshbabu,K., Batra,K., Sharma,T.R.,
 
−
            Mohapatra,T., Singh,N.K., Messing,J., Nelson,A.B., Fuks,G.,
 
−
            Kavchok,S., Keizer,G., Linton,E., Llaca,V., Song,R., Tanyolac,B.,
 
−
            Young,S., Ho-Il,K., Hahn,J.H., Sangsakoo,G., Vanavichit,A., de
 
−
            Mattos,Luiz.A.T., Zimmer,P.D., Malone,G., Dellagostin,O., de
 
−
            Oliveira,A.C., Bevan,M., Bancroft,I., Minx,P., Cordum,H.,
 
−
            Wilson,R., Cheng,Z., Jin,W., Jiang,J., Leong,S.A., Iwama,H.,
 
−
            Gojobori,T., Itoh,T., Niimura,Y., Fujii,Y., Habara,T., Sakai,H.,
 
−
            Sato,Y., Wilson,G., Kumar,K., McCouch,S., Juretic,N., Hoen,D.,
 
−
            Wright,S., Bruskiewich,R., Bureau,T., Miyao,A., Hirochika,H.,
 
−
            Nishikawa,T., Kadowaki,K., Sugiura,M., Burr,B. and Sasaki,T.
 
−
  CONSRTM  International Rice Genome Sequencing Project
 
−
  TITLE    The map-based sequence of the rice genome
 
−
  JOURNAL  Nature 436 (7052), 793-800 (2005)
 
−
  PUBMED  16100779
 
−
REFERENCE  5
 
−
  CONSRTM  IRGSP(International Rice Genome Sequencing Project)
 
−
  TITLE    Oryza sativa nipponbare(GA3) genomic DNA, chromosome 12
 
−
  JOURNAL  Unpublished
 
−
REFERENCE  6
 
−
  CONSRTM  The Rice Annotation Project (RAP)
 
−
  TITLE    The Second Rice Annotation Project Meeting (RAP2)
 
−
  JOURNAL  Unpublished
 
−
REFERENCE  7  (bases 1 to 1508)
 
−
  AUTHORS  Sasaki,T.
 
−
  TITLE    Direct Submission
 
−
  JOURNAL  Submitted (25-OCT-2004) Contact:Takuji Sasaki National Institute of
 
−
            Agrobiological Sciences, Rice Genome Research Program; Kannondai
 
−
            2-1-2, Tsukuba, Ibaraki 305-8602, Japan URL
 
−
            :http://rgp.dna.affrc.go.jp/
 
−
COMMENT    PROVISIONAL REFSEQ: This record has not yet been subject to final
 
−
            NCBI review. This record is derived from an annotated genomic
 
−
            sequence (NC_008405).
 
−
            On Jun 7, 2010 this sequence version replaced gi:115489405.
 
−
            The IRGSP pseudomolecules (Build 4.0).
 
−
            The orientation of the sequence is the short arm to the long arm of
 
−
            the chromosome.
 
−
            Genoscope, Evry cedex, France, URL:http://www.genoscope.cns.fr/,
 
−
            Tel:(33)0 1 60 87 25 00 Fax:(33)0 1 60 87 25 14
 
−
           
 
−
            The position of gaps in this pseudomolecule with unknown size is
 
−
            assigned 100 Ns based on the guideline set by DDBJ/EMBL/GenBank.
 
−
           
 
−
            This sequence entry was annotated by the Rice Annotation Project.
 
−
            http://rapdb.lab.nig.ac.jp/
 
−
FEATURES            Location/Qualifiers
 
−
    source          1..1508
 
−
                    /organism="Oryza sativa Japonica Group"
 
−
                    /mol_type="mRNA"
 
−
                    /cultivar="Nipponbare"
 
−
                    /db_xref="taxon:39947"
 
−
                    /chromosome="12"
 
−
    gene            1..1508
 
−
                    /gene="Os12g0597000"
 
−
                    /db_xref="GeneID:4352701"
 
−
    CDS            373..1050
 
−
                    /gene="Os12g0597000"
 
−
                    /note="Similar to Calcineurin B-like protein 2 (SOS3-like
 
−
                    calcium binding protein 1);
 
−
                    contains InterPro domain(s): IPR002048, IPR001125;
 
−
                    has GO asignment(s): GO:0005509;
 
−
                    supported by AK111887"
 
−
                    /codon_start=1
 
−
                    /product="hypothetical protein"
 
−
                    /protein_id="NP_001067190.1"
 
−
                    /db_xref="GI:115489406"
 
−
                    /db_xref="GeneID:4352701"
 
−
                    /translation="MVQCLDGVRQLLAVVFKCCDLELKQPRGLEDPQVLARETVFSVS
 
−
                    EVEALYELFKKISSAVIDDGLINKEEFQLALFKTSKKESLFADRVFDLFDTKHNGILG
 
−
                    FDEFARALSVFHPSAPLDEKIDFSFQLYDLKQQGYIERQEVKQMVVATLAESGMNLSD
 
−
                    EIIESIIDKTFEEADTKHDGRIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVF
 
−
                    HSQVDDT"
 
−
ORIGIN     
 
−
        1 agacgcacgc gcacacgcat acgcatcgca gccagttcat cctcgattcc tcccccgaat
 
 
       61 ttccttcgcg atctcacccc gcgtgcccta gctagctatc gaatcccgtc acctcggcgg
 
       61 ttccttcgcg atctcacccc gcgtgcccta gctagctatc gaatcccgtc acctcggcgg
 
       121 cggcggcgag atcggagctc cgggttaacc tcatccaccg cgaggcgtgg aacctctctc
 
       121 cggcggcgag atcggagctc cgggttaacc tcatccaccg cgaggcgtgg aacctctctc
Line 218: Line 54:
 
     1381 ttttgtgaat ctttcatttt gcgtacaaaa taggaacctt caaaaaaatt gatcgtgctg
 
     1381 ttttgtgaat ctttcatttt gcgtacaaaa taggaacctt caaaaaaatt gatcgtgctg
 
     1441 gaaaatgttc tgttggagtt tgcaaattgc aatgatcatg aaatgctctc cttttttgag
 
     1441 gaaaatgttc tgttggagtt tgcaaattgc aatgatcatg aaatgctctc cttttttgag
−
     1501 agtttgca
+
     1501 agtttgca|

Revision as of 04:18, 28 May 2014

Please cite: 李志涛 (2014) Gene: "Os12g0101600" in RiceWiki, available at http://ricewiki.big.ac.cn/index.php?title=Os12g0101600&action=edit&redlink=1

Annotated Information

Function

Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots. Please input function information here.

Expression

The ricenarrow leaf2andnarrow leaf3loci encode WUSCHELrelated homeobox 3A (OsWOX3A) and function in leaf, spikelet,tiller and lateral root development.nal2/3 mutation negatively affects both vegetative and reproductive organ development with a severe loss of grain yield. Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) athere

Mutation

narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.

Structured Information

LOCUS = NM_001073722 1508 bp mRNA linear PLN 08-JUN-2010 DEFINITION = Oryza sativa Japonica Group Os12g0597000 (Os12g0597000) mRNA, 

           complete cds.|

ACCESSION = NM_001073722| VERSION = NM_001073722.2 GI:297613475| KEYWORDS = RefSeq.| SOURCE = Oryza sativa Japonica Group (Japanese rice)| 

 ORGANISM = Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.|

ORIGIN = 1 agacgcacgc gcacacgcat acgcatcgca gccagttcat cctcgattcc tcccccgaat 

      61 ttccttcgcg atctcacccc gcgtgcccta gctagctatc gaatcccgtc acctcggcgg
     121 cggcggcgag atcggagctc cgggttaacc tcatccaccg cgaggcgtgg aacctctctc
     181 tctctcgctc tcaccacctg aggatcgaag atcgaaaccc ctggcaccgg ctcgggccgc
     241 ggaatgggcg gccgcggtga gtagctaggt ctgcggcggc ggagttgttg ttgttggtgg
     301 tggtggtggt ggaggaggag ttggcggcgg agggggcggg ggcgttggtg gtggtggtgg
     361 tgggagagta tcatggtgca gtgtctcgac ggggtgaggc agctgctggc ggtcgtgttc
     421 aagtgctgcg acctcgagct gaagcagccg cgggggctcg aggatcccca ggtcctcgcg
     481 agggagaccg tcttcagcgt gagcgaggtc gaggcgctgt acgagctctt caagaagata
     541 agcagtgctg tgattgatga cgggctgatt aacaaggagg agtttcagtt ggcgctgttc
     601 aagaccagca agaaggagag cctgttcgcc gaccgtgtat ttgatttgtt tgacacaaaa
     661 cacaatggaa ttttaggatt tgatgaattt gctcgtgcac tctcagtatt tcatccaagt
     721 gctccacttg atgagaagat tgacttttca ttccagttat atgatctcaa gcaacaaggc
     781 tatattgaga gacaagaggt taagcagatg gttgttgcta cacttgctga gtctggaatg
     841 aatctttctg atgaaattat agagagcata atcgataaga catttgagga ggcagacaca
     901 aagcatgatg gaagaattga taaagaagag tggcgcaatc tggttcttcg tcatccctct
     961 ttgctgaaga acatgactct ccagtacctc aaggacatca ccactacatt tccaagcttt
    1021 gtcttccatt cccaggtcga tgacacctga attcttggat ttgtttgaac tcaaaccatc
    1081 agaagaatgc tcatgccggt tcattaagaa ttttgatatt gggttgttgg attgggcaga
    1141 gactccagag ctctgtagga tgttgcatgt tcgatttgag aagttctcaa atctttaaat
    1201 tgatgtaact ttgtttcttt cgtttggaag tttagtgtgg ctggagactt tcggggagat
    1261 gttaaatttc tgtctgaatc cgtagatcct ttattctctt cccctctttt ctgtttttct
    1321 ggctagcaat cagaatatct tttctgtttt tttggctagc aatcagaata tcggatatag
    1381 ttttgtgaat ctttcatttt gcgtacaaaa taggaacctt caaaaaaatt gatcgtgctg
    1441 gaaaatgttc tgttggagtt tgcaaattgc aatgatcatg aaatgctctc cttttttgag
    1501 agtttgca|
Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os12g0101600&oldid=173430"