Difference between revisions of "Os01g0853400"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
The F-box protein coronatine insensitive 1 (COI1), a component of the SCF E3 ubiquitin ligase, has been identified as a principal component of a receptor of JA in  Arabidopsisand other plants, and the JA ZIM domain (JAZ) family proteins are key regulators of JA signaling that repress transcription of JA-responsive genes through interaction with transcription factors, such as MYC2 . This transcriptional repression requires novel interactor of JAZ (NINJA) and TOPLESS corepressor proteins. Bioactive JA, the jasmonoyl-isoleucine conjugate, promotes physical interaction between COI1 and JAZ proteins that results in degradation of JAZs by the 26S proteasome, leading to initiation of JA responses. Therefore, the SCF COI1 –JAZ protein complex acts as a core site of JA perception. As a regulatory loop, JA also activates JAZ gene transcription, leading to thedown-regulation of JA action and the dynamic nature of JA response.
+
The F-box protein coronatine insensitive 1 (COI1),(The rice genome contains two closely related COI1genes, OsCOI1a(Os01g0853400) and OsCOI1b(Os05g0449500), which share 83% and 82% sequence identity at the DNA and protein levels, respectively.) a component of the SCF E3 ubiquitin ligase, has been identified as a principal component of a receptor of JA in  Arabidopsisand other plants, and the JA ZIM domain (JAZ) family proteins are key regulators of JA signaling that repress transcription of JA-responsive genes through interaction with transcription factors, such as MYC2 . This transcriptional repression requires novel interactor of JAZ (NINJA) and TOPLESS corepressor proteins. Bioactive JA, the jasmonoyl-isoleucine conjugate, promotes physical interaction between COI1 and JAZ proteins that results in degradation of JAZs by the 26S proteasome, leading to initiation of JA responses. Therefore, the SCF COI1 –JAZ protein complex acts as a core site of JA perception. As a regulatory loop, JA also activates JAZ gene transcription, leading to thedown-regulation of JA action and the dynamic nature of JA response.
  
 
===Expression===
 
===Expression===

Revision as of 11:56, 8 June 2014

Please input one-sentence summary here.

Annotated Information

Function

The F-box protein coronatine insensitive 1 (COI1),(The rice genome contains two closely related COI1genes, OsCOI1a(Os01g0853400) and OsCOI1b(Os05g0449500), which share 83% and 82% sequence identity at the DNA and protein levels, respectively.) a component of the SCF E3 ubiquitin ligase, has been identified as a principal component of a receptor of JA in Arabidopsisand other plants, and the JA ZIM domain (JAZ) family proteins are key regulators of JA signaling that repress transcription of JA-responsive genes through interaction with transcription factors, such as MYC2 . This transcriptional repression requires novel interactor of JAZ (NINJA) and TOPLESS corepressor proteins. Bioactive JA, the jasmonoyl-isoleucine conjugate, promotes physical interaction between COI1 and JAZ proteins that results in degradation of JAZs by the 26S proteasome, leading to initiation of JA responses. Therefore, the SCF COI1 –JAZ protein complex acts as a core site of JA perception. As a regulatory loop, JA also activates JAZ gene transcription, leading to thedown-regulation of JA action and the dynamic nature of JA response.

Expression

Please input expression information here.

Evolution

The rice genome contains two closely related COI1genes, OsCOI1a(Os01g0853400) and OsCOI1b(Os05g0449500), which share 83% and 82% sequence identity at the DNA and protein levels, respectively.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0853400

Description

Similar to Coronatine-insensitive protein 1 (F-box/LRR-repeat protein 2) (AtFBL2) (COI-1) (AtCOI1)

Version

NM_001051366.2 GI:297597978 GeneID:4324818

Length

3825 bp

Definition

Oryza sativa Japonica Group Os01g0853400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:38502654..38506478

Sequence Coding Region

38502654..38502710,38503400..38503953,38505117..38505591,38505672..38506478

Expression

GEO Profiles:Os01g0853400

Genome Context

<gbrowseImage1> name=NC_008394:38502654..38506478 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:38502654..38506478 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcctccgtatgaaacagctagggcagagccagccagcaacaacaagcagcggccgatctccggcgagacggccgctgggagcagccgatccggccccgatccgatgggtggcgaggtgccggagccgcggcggctcaaccgggcgctcagcttcgacgactgggtccccgacgaggcgctgcacctcgtgatgggccacgtcgaggacccgcgggacagggaggcggcgtcgcgggtgtgccgccgctggcaccgcatcgacgcgctcacgcgcaagcacgtcaccgtcgccttctgctacgccgcgcgccccgcgcgcctccgggagcggttcccgcggctcgagtcgctctcgctcaagggcaagccccgcgccgccatgtacgggctcatccccgacgactggggcgcctacgccgcgccatggatcgacgagctcgccgcgccgctcgagtgcctcaaggcgctccacctccgccgcatgaccgtcaccgacgccgacatcgccgcccttgtccgcgcccgcggacacatgctgcaggagctcaagctcgacaagtgcatcggcttctccactgacgccctccgcctcgtcgcccgctcgtgcagatccctgagaactttatttctggaagagtgccatattactgataagggtggtgaatggcttcatgaacttgctgtcaacaattctgttctggtgacactgaacttctacatgactgaactcaaagtggcgccagctgatctagagcttcttgcaaagaattgcaagtcattgatttcattgaagatgagtgagtgtgatctttcagatctgattagtttttttcaaacagccaatgcgctgcaagactttgctggaggagcattctacgaggtaggagagctcaccaagtatgaaaaagttaagttcccacccagattatgcttcttggggcttacctacatgggaacaaatgagatgcctgttatcttccctttttcgatgaaactcaagaaactggacttgcaatacacttttctcacaacagaagatcattgtcagattattgcaaaatgtcccaatctactaattcttgaggtgaggaacgtgataggagatagagggctagaagttgttggtgatacatgcaagaagctacgaagactccgaattgagcggggtgatgatgatccaggtctgcaggaagagcaaggaggagtttctcagctaggcttgacagccgttgctgttggttgccgtgaattggagtacatagctgcctatgtatcggatatcaccaatggggccctggagtctattgggactttctgcaaaaatctatacgactttcggcttgtgctacttgacagagaaagacaggtaacagatctgccacttgacaatggtgtctgtgctctgttaagaaattgcacaaagcttcggaggtttgctctctaccttagaccaggagggctttcagatgatggccttagctacatcggacagtacagtggaaatatccaatacatgctactgggcaatgttggtgaatctgaccatggattgatccgtttcgcagtgggctgcaccaaccttcagaagcttgaattgagaagctgctgcttcagcgagcgagctttgtccctcgctgtactgcagatgccctccctgagatacatatgggtgcaaggatacagagcatctcaaacaggccttgacctcctgctcatggccaggcctttctggaacatcgagtttacacctccgagccctgagagttttaatcatatgacagaagatggagaaccctgtgtggatagccatgctcaggttcttgcctactattcccttgctggaaggaggtctgactgccctcagtgggtgatccccttgcatcctgcgtga</cdnaseq>

Protein Sequence

<aaseq>MPPYETARAEPASNNKQRPISGETAAGSSRSGPDPMGGEVPEPR RLNRALSFDDWVPDEALHLVMGHVEDPRDREAASRVCRRWHRIDALTRKHVTVAFCYA ARPARLRERFPRLESLSLKGKPRAAMYGLIPDDWGAYAAPWIDELAAPLECLKALHLR RMTVTDADIAALVRARGHMLQELKLDKCIGFSTDALRLVARSCRSLRTLFLEECHITD KGGEWLHELAVNNSVLVTLNFYMTELKVAPADLELLAKNCKSLISLKMSECDLSDLIS FFQTANALQDFAGGAFYEVGELTKYEKVKFPPRLCFLGLTYMGTNEMPVIFPFSMKLK KLDLQYTFLTTEDHCQIIAKCPNLLILEVRNVIGDRGLEVVGDTCKKLRRLRIERGDD DPGLQEEQGGVSQLGLTAVAVGCRELEYIAAYVSDITNGALESIGTFCKNLYDFRLVL LDRERQVTDLPLDNGVCALLRNCTKLRRFALYLRPGGLSDDGLSYIGQYSGNIQYMLL GNVGESDHGLIRFAVGCTNLQKLELRSCCFSERALSLAVLQMPSLRYIWVQGYRASQT GLDLLLMARPFWNIEFTPPSPESFNHMTEDGEPCVDSHAQVLAYYSLAGRRSDCPQWV IPLHPA</aaseq>

Gene Sequence

<dnaseqindica>1..57#747..1300#2464..2938#3019..3825#atgcctccgtatgaaacagctagggcagagccagccagcaacaacaagcagcggccggtacgcaataatggaactctccataagccaagcagaggagagagcggtgcggatgcaacagagtactgagagaaaacagagtattttacgcactgttgtcggctagctgtatccgtttgcgtttcagggtaaatccatccatcatcgatccattcatggtggtgggctgctggtggtggtggtggtgctatgctacaggttaatttaggcgatgcttacgtgatgctaacacccagttaacgtggctagggctacgctaagcaaggagcattgaattcgatcgatatgttgggttttttctctttactagtagcatgccatctagtgtgcatcttacgtagtggaatattatcgggcacccaatattcggctcgcacaaagctccgaggacgaggaggaggacgactaatttggcagctcagctcacctgcacggctgcactgtgctgtgcccggtgggcgaagccatttcacccgcgggcttacgtggcccggcaccaccggccgagccgtgcggggaaacaagtaaacgctcgctcgctgcgtctccgatgcccccgtccccgcctggccgctgctgctctctcgctcttctccctccaataattcgcttgccctctggtggctcaaagcccagggaaattgatggagaagaattggggtagccccatgccacctggttcgggctagatctccggcgagacggccgctgggagcagccgatccggccccgatccgatgggtggcgaggtgccggagccgcggcggctcaaccgggcgctcagcttcgacgactgggtccccgacgaggcgctgcacctcgtgatgggccacgtcgaggacccgcgggacagggaggcggcgtcgcgggtgtgccgccgctggcaccgcatcgacgcgctcacgcgcaagcacgtcaccgtcgccttctgctacgccgcgcgccccgcgcgcctccgggagcggttcccgcggctcgagtcgctctcgctcaagggcaagccccgcgccgccatgtacgggctcatccccgacgactggggcgcctacgccgcgccatggatcgacgagctcgccgcgccgctcgagtgcctcaaggcgctccacctccgccgcatgaccgtcaccgacgccgacatcgccgcccttgtccgcgcccgcggacacatgctgcaggagctcaagctcgacaagtgcatcggcttctccactgacgccctccgcctcgtcgcccgctcgtgcaggtaacccaggagttctctctttcttgtactactcatctgtaacagtgattttttttacctccaatacttgcctaagcgaaagttagcagcagcaactgagcagttggtcttttcctcatttagaagttagggttgatctggtggaggtgctaattttgttgttagttggtgttcctaaatggagtaatggatagtagtgacatgttcttagtgttctaacatgggcaagcaaagttgagccaaccttgctcactttctggttcacaaattcctcccccccccccccctcgagaaaggagctgtcacaaattagcttccacagtccactcgtgactggttgaggccataacgcaccgaatttcaacagcaaaatttgtgagcattagatgcgcacaagatttttgcctcaatagatttgtgtggttctttcgtttacctactttcattatttcatctaattgtgtacttgttgagctgggtttgagaagagtccctaatacataaaaacaacttataagaggtagcaagtctggcataagcaatctgctataatttgaggcagacccataacggttggtcatatatcttttaccaggagtaagtactattgtaatggttggattgtacttgaaaaggactaccctgttcctccttagacatatttggaaccaaaatacagttgcaagttggggattatgttgccgccttgccggtcagttatatcatgctccgatttgtgcggcagtatgtcttgtctcatgtttcttgttaactttgcttagtttgactttgagttcgcaacaatgatgtcgcaccaattatccgttaaaaaaaatttataaagaacgcaagaatattttgtgctaaaggtatatatttatttttgagacctaacttgtgaagtctgcatgcatatggagatgtgtggggtggatgaccagtaataccttgtgtggaatgcatgtatgggatgctttgtgatggttggaagtacttcacaagtcactacacatctactatgagttgctatgtttcttgacttaaaatgtgattcctgttctttcctccaatatatatttcttctaacagcaatttcttcatgctcaatgctaagattacatgctatctctgcagtaacatgtcattctaaattatgtcaacagatccctgagaactttatttctggaagagtgccatattactgataagggtggtgaatggcttcatgaacttgctgtcaacaattctgttctggtgacactgaacttctacatgactgaactcaaagtggcgccagctgatctagagcttcttgcaaagaattgcaagtcattgatttcattgaagatgagtgagtgtgatctttcagatctgattagtttttttcaaacagccaatgcgctgcaagactttgctggaggagcattctacgaggtaggagagctcaccaagtatgaaaaagttaagttcccacccagattatgcttcttggggcttacctacatgggaacaaatgagatgcctgttatcttccctttttcgatgaaactcaagaaactggacttgcaatacacttttctcacaacagaagatcattgtcagattattgcaaaatgtcccaatctactaattcttgaggtaatatttcctgtatacaagcattgattaattgtgtttgaattagtatatgccatattacaacgagatgtcctcaacaggtgaggaacgtgataggagatagagggctagaagttgttggtgatacatgcaagaagctacgaagactccgaattgagcggggtgatgatgatccaggtctgcaggaagagcaaggaggagtttctcagctaggcttgacagccgttgctgttggttgccgtgaattggagtacatagctgcctatgtatcggatatcaccaatggggccctggagtctattgggactttctgcaaaaatctatacgactttcggcttgtgctacttgacagagaaagacaggtaacagatctgccacttgacaatggtgtctgtgctctgttaagaaattgcacaaagcttcggaggtttgctctctaccttagaccaggagggctttcagatgatggccttagctacatcggacagtacagtggaaatatccaatacatgctactgggcaatgttggtgaatctgaccatggattgatccgtttcgcagtgggctgcaccaaccttcagaagcttgaattgagaagctgctgcttcagcgagcgagctttgtccctcgctgtactgcagatgccctccctgagatacatatgggtgcaaggatacagagcatctcaaacaggccttgacctcctgctcatggccaggcctttctggaacatcgagtttacacctccgagccctgagagttttaatcatatgacagaagatggagaaccctgtgtggatagccatgctcaggttcttgcctactattcccttgctggaaggaggtctgactgccctcagtgggtgatccccttgcatcctgcgtga</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0853400, RefSeq:Os01g0853400