Difference between revisions of "Os05g0597100"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
OsHDT1 over-expression affects the flowering time of hybrid rice;
 
OsHDT1 over-expression affects the flowering time of hybrid rice;
 +
increased OsHDT1 level may alter flowering time-related gene expression in the hybrid, while without a clear effect in the parent background.
 +
 
OsHDT1 over-expression suppresses overdominance expression of flowering time genes in hybrid rice;
 
OsHDT1 over-expression suppresses overdominance expression of flowering time genes in hybrid rice;
 +
increased OsHDT1 expression suppressed the overdominance expression of OsGI and Hd1 in the hybrid under long day conditions, which led to early flowering.
 +
 
Impact of altered OsHDT1 levels on gene expression in rice hybrid;
 
Impact of altered OsHDT1 levels on gene expression in rice hybrid;
 +
OsHDT1 over-expression had a negative impact on histone H4 acetylation on these genes in both parent and hybrid backgrounds.
  
 
===Expression===
 
===Expression===

Revision as of 11:09, 11 May 2014

OsHDT1(Os05g0597100),is a histone deacetylase gene, that is involed in flowering time control and innate immunity in rice.

Annotated Information

Function

OsHDT1 over-expression affects the flowering time of hybrid rice; increased OsHDT1 level may alter flowering time-related gene expression in the hybrid, while without a clear effect in the parent background.

OsHDT1 over-expression suppresses overdominance expression of flowering time genes in hybrid rice; increased OsHDT1 expression suppressed the overdominance expression of OsGI and Hd1 in the hybrid under long day conditions, which led to early flowering.

Impact of altered OsHDT1 levels on gene expression in rice hybrid; OsHDT1 over-expression had a negative impact on histone H4 acetylation on these genes in both parent and hybrid backgrounds.

Expression

OsHDT1 expression displays a circadian rhythm: OsHDT1 expression exhibited also a circadian oscillation and was sensitive to photoperiods .

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Li C, Huang L, Xu C, Zhao Y, Zhou DX (2011) Altered levels of histone deacetylase OsHDT1 affect differential gene expression patterns in hybrid rice. PLoS ONE 6:e21789

Structured Information

Gene Name

Os05g0597100

Description

Similar to Nucleolar histone deacetylase HD2-p39

Version

NM_001063058.1 GI:115465846 GeneID:4339823

Length

2800 bp

Definition

Oryza sativa Japonica Group Os05g0597100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:29835095..29837894

Sequence Coding Region

29835401..29835461,29835543..29835675,29835762..29835858,29835978..29836046,29836126..29836283
,29836388..29836432,29836503..29836530,29836661..29836879,29836980..29837050
,29837799..29837811

Expression

GEO Profiles:Os05g0597100

Genome Context

<gbrowseImage1> name=NC_008398:29835095..29837894 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:29835095..29837894 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagttctggggtcttgaagtcaagcctggacagactgtcaaatgtgagcctgaagatgaacgctttttgcacctttctcaggctgctcttggggaatcaaagaaaggatctgacaatgcagtaatgtatgttaaaactgatgatcaaaagctagtcattggaaccctctcagctgacaagttccctcaaatccagtttgatttggtctttgacaaagagtttgagctgtcacacacttcaaagactgctagtgtgttcttttctggctacaaagtttcccagccggctgaggaagatgaaatggattttgattctgaagaagttgaagatgaagaggaggaagaaaagatcattccagctcccagggcaaatggcaaagttgaagggaaggaaaatgagcagaaaaaacaaggcaagacagattcttcagcttcaaaatcaaaggctgcagtgaatgacgatgatgatgatgatgacagtgatgaggatgattctgaggacgaagatctttctcctgaggatgatgatgatgattcttctgaggatgattccagcgaagatgatgaggatgagagtgacgaggaagatactcccaagaagccagagactggaaagaggaaagtagctgaaattgtgttgaagacaccttcgtctgataagaaagcaaagattgctacaccgtcaggccagaagacaggtgacaagaagggtgtccatgtagcaactccacatccggcaaagcaggctagcaagacccccgtgaatgacaagtcaaaggagaagtccccaaaatccggtggtgggtcaatttcttgcaagtcatgcagcaagacgttcaacagtgaaatggctctgcaatctcactcgaaggccaagcaccccgccaagtga</cdnaseq>

Protein Sequence

<aaseq>MEFWGLEVKPGQTVKCEPEDERFLHLSQAALGESKKGSDNAVMY VKTDDQKLVIGTLSADKFPQIQFDLVFDKEFELSHTSKTASVFFSGYKVSQPAEEDEM DFDSEEVEDEEEEEKIIPAPRANGKVEGKENEQKKQGKTDSSASKSKAAVNDDDDDDD SDEDDSEDEDLSPEDDDDDSSEDDSSEDDEDESDEEDTPKKPETGKRKVAEIVLKTPS SDKKAKIATPSGQKTGDKKGVHVATPHPAKQASKTPVNDKSKEKSPKSGGGSISCKSC SKTFNSEMALQSHSKAKHPAK</aaseq>

Gene Sequence

<dnaseqindica>2434..2494#2220..2352#2037..2133#1849..1917#1612..1769#1463..1507#1365..1392#1016..1234#845..915#84..96#agccttaaaccctagctccgcctcccacctcccttttcttttctagggttcttccgccgccgccgccgccgccgccgattccgatggagttctggggtaatctcctcctctacctctctctcttcccctccctctctccatccatctatattgcgcagtttcggtttttgtttgatttgatttggacgcgattcgtttgatacggtgtttggttcgtgcgcttctcttcgttacggattagacgcgattcgtttcaccatcgagtgttttgggttcgcgcggaatcgcggccatggctcttccctgtcttcgttagggattaattagggattttagttttcatgggccgcgactatttccatcatacatgcgtaaccgcattggttgccgcctttatgtttgcgagaatcatcattttgttcattctgtttctgtttcagttaacacattctgattatcttcagtctcatagttgttatcatatattactacagtacttaccttgcttcggccccatcgtttggcatatttacgaacgaaaaataatttgtgaataaaacttagcgatctaaaagaaaaggctgaaaaataaacttctgaaaacctccaaaatcaactccaaatttaagattgaaaattcaaattttggctgataagcataagcggaaagataaggtcgcttgtttctatgggccatcctcgttaatttactatgctagttgcttttcaactttactagctaaaggcaaatatgaactgtagtatactgtttcattcatgccttcttggaagggaaggactactctatacatgtgtttttcgctgattagtcaaagttgtgcaggtcttgaagtcaagcctggacagactgtcaaatgtgagcctgaagatgaacgctttttgcacctttctcaggtttattatgttcctcttctgtcctcctttttttgaacagtgaggcttttgtgttctcattgtgtacttaatcttttgttattcaacaattgcttggtaggctgctcttggggaatcaaagaaaggatctgacaatgcagtaatgtatgttaaaactgatgatcaaaagctagtcattggaaccctctcagctgacaagttccctcaaatccagtttgatttggtctttgacaaagagtttgagctgtcacacacttcaaagactgctagtgtgttcttttctggctacaaagtttcccagccggctgaggaagatgaatatcctttgtaatgttttaccatgtttggtcaatatatgtaatgcatataatgtcatactctattttattttcattaaggtatgtattacaatattgttttccttgacctgccttttttgttgttccacaatggattttgattctgaagaagttgaaggtatgattgctactagtgcttgtgttctgcctagagagaatttaacgagcctgtttataatttatttcagatgaagaggaggaagaaaagatcattccagctcccagggcaaatggtaccatagtttctcctttctgattatgattggaatcacagaatccttttgcacctctctttaaaactttataaggaagtacttatgactaaaacttttctaaggcaaagttgaagggaaggaaaatgagcagaaaaaacaaggcaagacagattcttcagcttcaaaatcaaaggctgcagtgaatgacgatgatgatgatgatgacagtgatgaggatgattctgaggacgaagatctttctcctgaggatgatgatgatgtgagtaatttatgggtactgttgtgtattattgtggaggattgttccatactaacagtggtgcaatggcctgttataggattcttctgaggatgattccagcgaagatgatgaggatgagagtgacgaggaagatactcccaagaaggtatgtgtatgtgtttgaaggatatagtctgcttgtttctgtgcacttatatgtgtttgaaggatacagttagtttgtttgttctgtactcttaccataaacaatgtgatgacttgcagccagagactggaaagaggaaagtagctgaaattgtgttgaagacaccttcgtctgataagaaagcaaagattgctacaccgtcaggccagaagacaggttagtagctgtgaagctgcgcctgcgatgaataaattggcactggaagtagtgatgaatttgtatcatttggtcctcctgagcaggtgacaagaagggtgtccatgtagcaactccacatccggcaaagcaggctagcaagacccccgtgaatgacaagtcaaaggagaagtccccaaaatccggtggtgggtcaatttcttgcaagtcatgcagcaagtaagtttagatgcgctgtcttcttgttttggagtattacgtaaggaaatgattcaaagtttgcatgaatgcattgtttaggacgttcaacagtgaaatggctctgcaatctcactcgaaggccaagcaccccgccaagtgaagaatgagacaacggatgctgagctgagaaatattggtgtcgtttgagttggttatctgaaatgaaatgaaatgctgcaaactatttggtgttatgagtagtgtcgtgacggtttatgtggtgcaaactatttagtctagaaaaaaaaaatctgtggtgcgaactgagctacaattttattcggtcaaggtcagtggagtgattggtttattttggatggaattattgttcttccctgttattcggttaattcccacgagaaaggattgataacaccacactgaattgactagctgaacaaagtcg</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0597100, RefSeq:Os05g0597100