Difference between revisions of "Os05g0333200"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
The d1 mutant, which is deficient for the heterotrimeric G-protein α subunit (G α ) gene of rice, shows dwarfi sm and sets small round seeds. Heterotrimeric G proteins, which are composed of α (G α ),β (G β ) and γ (G γ ) subunits, play a variety of roles in a wide range of physiological responses by transducing extracellular information to intracellular components. Heterotrimeric G proteins act as signal transducer between a receptor (G-protein-coupled receptors, GPCRs) and downstream effectors. G-protein signaling starts with a conformational change of the GPCR upon ligand perception.
+
The d1 mutant, which is deficient for the heterotrimeric G-protein α subunit (G α ) gene of rice, shows dwarfi sm and sets small round seeds. Heterotrimeric G proteins, which are composed of α (G α ),β (G β ) and γ (G γ ) subunits, play a variety of roles in a wide range of physiological responses by transducing extracellular information to intracellular components. Heterotrimeric G proteins act as signal transducer between a receptor (G-protein-coupled receptors, GPCRs) and downstream effectors. G-protein signaling starts with a conformational change of the GPCR upon ligand perception.The GPCR is a guanine-nucleotide-exchange
 +
factor (GEF) and its activation by the ligand promotes the exchange of GDP for GTP in the associated G α subunit. Subsequently, this complex dissociates into a G α -GTP monomer and a G β γ dimer to regulate downstream effectors. Mammals have multiples of each of the > 20 G α , 5 G β and 11 G γgenes
  
 
===Expression===
 
===Expression===

Revision as of 12:17, 11 May 2014

Please input one-sentence summary here.

Annotated Information

Function

The d1 mutant, which is deficient for the heterotrimeric G-protein α subunit (G α ) gene of rice, shows dwarfi sm and sets small round seeds. Heterotrimeric G proteins, which are composed of α (G α ),β (G β ) and γ (G γ ) subunits, play a variety of roles in a wide range of physiological responses by transducing extracellular information to intracellular components. Heterotrimeric G proteins act as signal transducer between a receptor (G-protein-coupled receptors, GPCRs) and downstream effectors. G-protein signaling starts with a conformational change of the GPCR upon ligand perception.The GPCR is a guanine-nucleotide-exchange factor (GEF) and its activation by the ligand promotes the exchange of GDP for GTP in the associated G α subunit. Subsequently, this complex dissociates into a G α -GTP monomer and a G β γ dimer to regulate downstream effectors. Mammals have multiples of each of the > 20 G α , 5 G β and 11 G γgenes

Expression

Please input expression information here. Heterotrimeric G proteins, which are composed of α (G α ),β (G β ) and γ (G γ ) subunits, play a variety of roles in a wide range of physiological responses by transducing extracellular information to intracellular components

Evolution

Please input evolution information here.

You can also add sub-section(s) at will. In the shoot hypocotyl, the maximum cell length in gpa1 was not different from that in WT while the cell number was signifi cantly reduced. Our results support the idea that G α s regulate cell proliferation.

Labs working on this gene

Please input related labs here. 1 Department of Bioscience, Fukui Prefectural University, 4-1-1 Matsuoka Kenjyojima, Eiheiji-cho, Yoshida-gun, Fukui, 910-1195 Japan 2 Bioscience and Biotechnology Center, Nagoya University, Chikusa, Nagoya, 464-8604 Japan

References

Please input cited references here. 1. Yuki Izawa;Yoshiyuki Takayanagi;Noriko Inaba;Yuki Abe;Miho Minami;Yukiko Fujisawa;Hisaharu Kato;Shizuka Ohki;Hidemi Kitano;Yukimoto Iwasaki

 Function and Expression Pattern of the α Subunit of the Heterotrimeric G Protein in Rice
 Plant and Cell Physiology, 2010, 51(2): 271-281

2. Kotaro Miura;Masakazu Agetsuma;Hidemi Kitano;Atsushi Yoshimura;Makoto Matsuoka;Steven E. Jacobsen;Motoyuki Ashikari

 A metastable DWARF1 epigenetic mutant affecting plant stature in rice
 Proceedings of the National Academy of Sciences, 2009, 106(27): 11218-11223

3. Lei Wang;Yun-Yuan Xu;Qi-Bin Ma;Dan Li;Zhi-Hong Xu;Kang Chong

 Heterotrimeric G protein α subunit is involved in rice brassinosteroid response
 Cell Research, 2006, 16(12): 916-922

4. Miyako Ueguchi-Tanaka;Yukiko Fujisawa;Masatomo Kobayashi;Motoyuki Ashikari;Yukimoto Iwasaki;Hidemi Kitano;Makoto Matsuoka

 Rice dwarf mutant d1, which is defective in the α subunit of the heterotrimeric G protein, affects gibberellin signal transduction
 Proceedings of the National Academy of Sciences, 2000, 97(21): 11638-11643

5. Motoyuki Ashikari;Jianzhong Wu;Masahiro Yano;Takuji Sasaki;and Atsushi Yoshimura

 Rice gibberellin-insensitive dwarf mutant gene Dwarf 1 encodes the α-subunit of GTP-binding protein
 Proceedings of the National Academy of Sciences, 1999, 96(18): 10284-10289

6. Yukiko Fujisawa;Teruhisa Kato;Shizuka Ohki;Atsushi Ishikawa;Hidemi Kitano;Takuji Sasaki;Tadashi Asahi;and Yukimoto Iwasaki

 Suppression of the heterotrimeric G protein causes abnormal morphology, including dwarfism, in rice
 Proceedings of the National Academy of Sciences, 1999, 96(13): 7575-7580

7. Atsushi Ishikawa;Hitoshi Tsubouchi;Yukimoto Iwasaki;Tadashi Asahi

 Molecular Cloning and Characterization of a cDNA for the α Subunit of a G Protein from Rice
 Plant and Cell Physiology, 1995, 36(2): 353-359

Structured Information

Gene Name

Os05g0333200

Description

Guanine nucleotide-binding protein alpha-1 subunit (GP-alpha-1)

Version

NM_001061761.1 GI:115463252 GeneID:4338448

Length

4020 bp

Definition

Oryza sativa Japonica Group Os05g0333200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:15587381..15591400

Sequence Coding Region

15587656..15587821,15587986..15588065,15588143..15588202,15588289..15588382,15588459..15588593
,15588773..15588828,15589531..15589632,15589716..15589823,15590378..15590455
,15590604..15590693,15590775..15590812,15591062..15591134,15591233..15591325

Expression

GEO Profiles:Os05g0333200

Genome Context

<gbrowseImage1> name=NC_008398:15587381..15591400 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:15587381..15591400 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtccgtgcttacctgtgtgcttgataacatgggctcatcctgtagcagatctcattctttaagtgaggctgaaacaaccaaaaatgcaaaatctgcagacattgacaggcgaattttgcaagagacaaaagcagagcaacacatccacaagctcttacttcttggtgcgggagaatcagggaagtctacgatatttaaacagattaagctccttttccaaactggctttgatgaggcagaacttaggagctacacatcagttatccatgcaaacgtctatcagacaattaaaatactatatgaaggagcaaaagaactctcacaagtggaatcagattcctcaaagtatgttatatccccagataaccaggaaattggagaaaaactatcagatattgatggcaggttggattatccactgctgaacaaagaacttgtactcgatgtaaaaaggttatggcaagacccagccattcaggaaacttacttacgtggaagtattctgcaacttcctgattgtgcacaatacttcatggaaaatttggatcgattagctgaagcaggttatgtgccaacaaaggaggatgtgctttatgcaagagtacggacaaatggtgttgtacaaatacaatttagtcctgttggagaaaacaaaagaggtggagaggtatataggttgtatgatgtaggaggccagaggaatgagaggagaaagtggattcatctttttgaaggtgttaatgcggtaatcttttgtgctgccattagcgaatatgatcagatgctatttgaagatgagacaaaaaacagaatgatggagaccaaggaactctttgactgggttttaaagcaaagatgttttgagaaaacatcattcattctgtttctcaacaaatttgatatattcgagaagaaaatacaaaaggttcctttaagtgtgtgcgagtggtttaaagactaccagcctattgcacctgggaaacaggaggttgaacatgcatatgagtttgtcaagaagaagtttgaagagctctacttccagagcagcaagcctgaccgtgtggaccgcgtcttcaaaatctacagaactacggccctagaccagaaacttgtaaagaagacattcaagttgattgatgagagcatgagacgctccagggaaggaacttga</cdnaseq>

Protein Sequence

<aaseq>MSVLTCVLDNMGSSCSRSHSLSEAETTKNAKSADIDRRILQETK AEQHIHKLLLLGAGESGKSTIFKQIKLLFQTGFDEAELRSYTSVIHANVYQTIKILYE GAKELSQVESDSSKYVISPDNQEIGEKLSDIDGRLDYPLLNKELVLDVKRLWQDPAIQ ETYLRGSILQLPDCAQYFMENLDRLAEAGYVPTKEDVLYARVRTNGVVQIQFSPVGEN KRGGEVYRLYDVGGQRNERRKWIHLFEGVNAVIFCAAISEYDQMLFEDETKNRMMETK ELFDWVLKQRCFEKTSFILFLNKFDIFEKKIQKVPLSVCEWFKDYQPIAPGKQEVEHA YEFVKKKFEELYFQSSKPDRVDRVFKIYRTTALDQKLVKKTFKLIDESMRRSREGT</aaseq>

Gene Sequence

<dnaseqindica>3580..3745#3336..3415#3199..3258#3019..3112#2808..2942#2573..2628#1769..1870#1578..1685#946..1023#708..797#589..626#267..339#76..168#ggatcctgagatctagacgtcaacgtgcttcctggaaagagagaggctcaggcatgagagcatacctctaaaataatgtccgtgcttacctgtgtgcttgataacatgggctcatcctgtagcagatctcattctttaagtgaggctgaaacaaccaaaaatgcaaaagtaagttagcactcggacttattgaacaagtaaatgctaactcaattcttgatttgagagttgccacatttggtttcttctaattcagctggtaacagtctgcagacattgacaggcgaattttgcaagagacaaaagcagagcaacacatccacaagctcttacttcttggtattgctaactttcccaaatttaagtggtcattttccttgtcacaattatctgtgctacctttagtatctattggttcagaaaattaattgtttatgttgttcctatttacctctataaaaaaacctttctcatgttatttccaaaaaaaaagaagataaataaatgtatcctagaaatttttagtttgaacttgttctcaatgtggatccatccttctttctctctctcaattgcttctgttttaaggtgcgggagaatcagggaagtctacgatatttaaacaggtgatgaatgttatattccatggagaatcataatccgtacgccgctagttagtctgatgtattcttactgttcacctgcagattaagctccttttccaaactggctttgatgaggcagaacttaggagctacacatcagttatccatgcaaacgtctatcagacaattaaagtatgcaatactggaaagggtgtgtcttttttttcttattgcaaagtggggattatgtaggagattcgactagggatttgtattctgttcataaggaaatgcgttcatacttttcctttttgtcgagtaatgtgttaaatgttaacagatactatatgaaggagcaaaagaactctcacaagtggaatcagattcctcaaagtatgttatatccccagataaccaggtttgtgcttactctttactcaacagttaaagctaaatctgtgcatatgaacatgtcttgttaaatctgggaatacaaacattttgatttgcaacatttctgttgtagtcaagctgctcggctctatgttttaacctgttaagaccttgtagactgtgctcggctctattgtagtcttatattttacacggtcattctataatgaaaacttgaaaaagatatctattgaaccgtacaatgtactgaacaaagtagaaaagaacaatgagattttgtaacatttattcttccttgtttatttgattgcttcagacaattgttgatatgctaaaaataacttggtatcaaatgtgggtgttataagattcaatttttttctcaaccaggttaaaaaaagtatacctttgtgcatttaccttgttccgttgctttggaactttaaaggaaaactgacttttcttaggcattgaaagacaaatatcaccagtttcacactgtacaccttaccaaccaattttgtttcttagatgtcatttactttgtcatatcatcaggaaattggagaaaaactatcagatattgatggcaggttggattatccactgctgaacaaagaacttgtactcgatgtaaaaaggttatggcaagacccagccattcaggtgaaaacaaatagccattcaaatcttttgaagttatatagttttcctggccaggtgtgctgaagcaatgctctatactgtaggaaacttacttacgtggaagtattctgcaacttcctgattgtgcacaatacttcatggaaaatttggatcgattagctgaagcaggttatgtgccaacaaaggtgtgctgtccatgttcatagacaattatttacatattctcagatatttgtgctgacaccatttcatgttgatttttagtctacttagtcagaggttgtcaaatggttaactatgtgtactgagtcagaggttgccaaatagttttaaaagatgggcatatgtttatccttatcttttaaataatattggaggctatcctttaaaattcaatattagggaggagaaactattattctaccgttattacgcagtctacataacgaaggtaaaaaatgtccctgtgaaacatagggtgcaaaactgctgtgaataaaactctacttatctaagcaccttgagcttttgagttcccacatattaatcttatgacactagcatatattttttttgttcagttccttcaataagttgcaaaccacaaatatgatcactgtaccatccacttttgcaaccatttcccgtcatttcttaagcatagaaaattgtttgtcacttgtttaagtccacactgcatcaaaattccaattaacattgtgtgtgctaagtgaagatatgactccatatttctgcatttagcagtctgatggataatttgtgattgtaccttgtctaatggttcgtttgaaaggctggtagttgatcttccatacttaagaatgcttgcagtattatagttgtcaatattatgagtcattttgcaggaggatgtgctttatgcaagagtacggacaaatggtgttgtacaaatacaatttaggtaatctgctgacactattttttgcacatttttttgctggttgctctactatgtacagaacgacaagttgaagtcctttttttctcccctttcacttctaagatatgacctgagaggttctgaatgtagctgttttaagatgagttgaatcatctagttaactgggtttctttctgcagtcctgttggagaaaacaaaagaggtggagaggtatataggttgtatgatgtaggaggccagaggaatgagaggagaaagtggattcatctttttgaaggtgttaatgcggtaatcttttgtgctgccattagcgagtaagtacaatttttttgattgttgaacttatcctaatctgctaagttcttctcataggcttcttgttcatttcagatatgatcagatgctatttgaagatgagacaaaaaacagaatgatggagaccaaggaactctttgactgggttttaaagcaaagatgttttgaggtctgcatgcatccatctctgcaacctttgtgctcatgctttttttctcattttgaaactaattacggtgctatattgaccatcagaaaacatcattcattctgtttctcaacaaatttgatatattcgagaagaaaatacaaaaggtaaggcctgctctttgtaccaatgcatagtttagtactaaatgttaccaacatttatgtttacgctggttacgtaggttcctttaagtgtgtgcgagtggtttaaagactaccagcctattgcacctgggaaacaggaggttgaacatgcatatgagtgagtgcactactcgccctctcagatgaacatgggcatttggccatttgtaatgttgctgcatggtgcacttatatgccttgataagtttttccattctaatgttatatagtatcaaacgttcatcattactgtggcttatggtctggagtgacgttttacaggtttgtcaagaagaagtttgaagagctctacttccagagcagcaagcctgaccgtgtggaccgcgtcttcaaaatctacagaactacggccctagaccagaaacttgtaaagaagacattcaagttgattgatgagagcatgagacgctccagggaaggaacttgattcagagctaagactaggttgtaagtcacacagggaaggtaattaggacggcgagaggaacaaagtttcacactgtcacagctttatctgttgtaattcttttacacgtggaccattgattgatcttttggttcttactgtgggctgttcaggtctgtaccctattttttgttctctagttagccattgtgcaaattttccttgaatcagattctctacctgttgtctatgtgtgttatcttggtctgttaatttgcatagcccacttgttcatt</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0333200, RefSeq:Os05g0333200