Difference between revisions of "Os05g0196500"

From RiceWiki
Jump to: navigation, search
(References)
(Function)
Line 4: Line 4:
 
   
 
   
 
===Function===
 
===Function===
This gene encodes a histone H3K4 demethylase —JMJ703 which involves in both transposon(TE) silencing and stem elongation in rice. ''jmj703'' mutants displayed pleiotropic phenotypes, the most obvious of which was dwarfism. JMJ703 is a JmjC domain-containing protein, which can specifically demethylate methylated histone H3 lysine 4 and reverse all three forms of H3K4me(mono-, di-, or trimethylation). It is required for TEs silencing. Impaired JMJ703 activity leads to elevated levels of H3K4me3, the misregulation of numerous endogenous genes, and the transpositional reactivation of two families of non-LTR retrotransposons(''Karma'' and ''LINE1''). However, loss of JMJ703 does not affect TEs (such as Tos17) previously found to be silenced by other epigenetic pathways, indicating that different subsets of TEs may be regulated by distinct epigenetic pathways. Besides, loss-of-function mutation of the gene reduces cell division rate of the stem and size of plant stature, showing the importance of this protein in plant growth.
+
This gene encodes a histone H3K4 demethylase —JMJ703 which involves in both transposon(TE) silencing and stem elongation in rice. ''jmj703'' mutants displayed pleiotropic phenotypes, the most obvious of which was dwarfism. JMJ703 is a JmjC domain-containing protein, which can specifically demethylate methylated histone H3 lysine 4 and reverse all three forms of H3K4me(mono-, di-, or trimethylation). It is required for TEs silencing. Impaired JMJ703 activity leads to elevated levels of H3K4me3, the misregulation of numerous endogenous genes, and the transpositional reactivation of two families of non-LTR retrotransposons(''Karma'' and ''LINE1''). However, loss of JMJ703 does not affect TEs (such as Tos17) previously found to be silenced by other epigenetic pathways, indicating that different subsets of TEs may be regulated by distinct epigenetic pathways.<ref name="ref1" /> Besides, loss-of-function mutation of the gene reduces cell division rate of the stem and size of plant stature, showing the importance of this protein in plant growth.<ref name="ref2" />
 
[[File: jmj703 mutants.png]]
 
[[File: jmj703 mutants.png]]
  

Revision as of 13:17, 14 May 2014

Please input one-sentence summary here.

Annotated Information

Function

This gene encodes a histone H3K4 demethylase —JMJ703 which involves in both transposon(TE) silencing and stem elongation in rice. jmj703 mutants displayed pleiotropic phenotypes, the most obvious of which was dwarfism. JMJ703 is a JmjC domain-containing protein, which can specifically demethylate methylated histone H3 lysine 4 and reverse all three forms of H3K4me(mono-, di-, or trimethylation). It is required for TEs silencing. Impaired JMJ703 activity leads to elevated levels of H3K4me3, the misregulation of numerous endogenous genes, and the transpositional reactivation of two families of non-LTR retrotransposons(Karma and LINE1). However, loss of JMJ703 does not affect TEs (such as Tos17) previously found to be silenced by other epigenetic pathways, indicating that different subsets of TEs may be regulated by distinct epigenetic pathways.[1] Besides, loss-of-function mutation of the gene reduces cell division rate of the stem and size of plant stature, showing the importance of this protein in plant growth.[2] File:Jmj703 mutants.png

Expression

JMJ703 is expressed at relatively high levels in leaves of 7 d-after-germination (DAG) seedlings compared with all of the other tissues tested. JMJ703 expression.PNG

Evolution

Plant JmjC proteins are conserved with yeast and animal homologues, but display several distinct features. JMJ703 is the homolog of the Arabidopsis H3K4 demethylase JMJ14, which is involved in flowering time regulation and gene silencing. The crystal structure of the catalytic domain of the protein shares a general similarity with that of mammalian and yeast proteins that demethylate methylated histone H3 lysine 9 and lysine 36, but displays several distinct structural features that are important for substrate and cofactor binding and enzymatic activity of the protein. It is found that key amino acids involved in the specific structures are conserved within known H3 lysine 4 demethylases, which may be involved in the specificity to histone H3 lysine 4.

Labs working on this gene

1.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan, China.

2.State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.

References

  1. Cui X, Jin P, Cui X, et al. Control of transposon activity by a histone H3K4 demethylase in rice[J]. Proceedings of the National Academy of Sciences, 2013, 110(5): 1953-1958.
  2. Chen Q, Chen X, Wang Q, et al. Structural basis of a histone H3 lysine 4 demethylase required for stem elongation in rice[J]. PLoS genetics, 2013, 9(1): e1003239.

Structured Information

Gene Name

Os05g0196500

Description

Transcription factor jumonji, JmjN domain containing protein

Version

NM_001061402.1 GI:115462534 GeneID:4338043

Length

6692 bp

Definition

Oryza sativa Japonica Group Os05g0196500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:5922219..5928910

Sequence Coding Region

5922819..5923145,5923247..5923327,5923412..5923489,5923595..5924062,5924414..5924638
,5924763..5924924,5925474..5925842,5925922..5927362,5927570..5927673
,5927752..5927949,5928247..5928510

Expression

GEO Profiles:Os05g0196500

Genome Context

<gbrowseImage1> name=NC_008398:5922219..5928910 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:5922219..5928910 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgatgggggttaccaccacgctcaacgaggacactgaaccctctattccacctggatttggaccttttgctacccttccgttatggggaatccacaatgatgccaaacctgctgttactcattctactcctgttcaagcattgcaaagcattagaaaagacagcgaagaatgccaacccagtgcggctgtgtctcggagtgatacaccttgcagcacttccggaacccagacatgcagaaaatcactgcgtaacagacccccaatagactatagccgctttgaacatatatcggatgaagattctgatgtcgaaatagtggaaaaggatgtaagttcaacgagacgcagacaacagctaccgaaaggagtacttcgaggatgtgcagaatgcagtgactgtcaaaaggttatcgcaaaatggaatccagctggtgcacgcaggcctgttcttgatgaggctcctgttttctatccaacagaggaggaatttgaagacactctaaaatacattgagagtatacggccaatggcggaaccatatggtatttgccgtattgtcccaccatcttcttggaagcctccatgccttcttaaagataaaagcatatgggaaggatcaaaattctctactcgggtacaaaaggttgacaagctccaaaaccgtaaatcatcaaaaaagggcagaagaggtggaatgatgaagaggagaaagcttgcagagtcagaggagaacagtgccactgctcacactcagacagggatgcagcaaagtccagagagatttggatttgaacctgggccagagttcacgttacagacatttcagaaatatgcagatgatttcagtaagcagtactttaggaaagatacatcgatggattcagtaccatcagtggaagatattgaaggtgagtactggcgcatcgttgaggttcccacagaagagatagaggtgatatatggtgctgatctggagactggaactttcggcagtggttttccaaaattatctcctgagacaaaatctgatgctgaggataaatatgcacaatctggttggaatctaaataacttgcctagactacaaggttcagttctttctttcgagggcggtgacatttctggtgttctagtgccttgggtgtatgttggcatgtgtttttcatcattctgctggcatgttgaagaccatcatttatactcactaaactacatgcattggggtgccccaaagttgtggtatggagttccaggaaaggatgctgtgaatttggaatctgcaatgaggaaacatctacctgaattatttgaggagcaacctgatttgctacacaaccttgttacccagttttcaccatcgctgctgaaatctgaaggagtacatgtataccgttgtgttcagcatgagggcgagtttgtcttgacattcccaagggcgtaccatgctggtttcaattgtggcttcaattgtgccgaagctgttaatgtggctcctattgattggttaccgattggacataatgctgtagagctttatcgtgagcaagctaggaaaataaccatttctcatgataagttgttgttgggggctgcaagagaagcaataagagctcagtgggatatcctattcctcaagaggaatactgctgataatatgaggtggaagagtatatgcggagctgatagcactatattcaaggctcttaaggcacgaattgagacagagttggtgcaaaggaaaactctaggtgttccagctcaatcaaggaaaatggatgctgaattcgattccattgatagggaatgtgccttgtgctactatgatttacatctttctgcttctggctgtccatgctgcccagagaaatatgcttgccttgtacatgcaaagcaactttgctcatgtgactgggacaaaaggtttttcctattccgctatgatgtcaatgagctaaatatcttagctgatgctttaggggggaaattaagtgccattcatagatggggcgtctctgatcttggattaagtttgagttcatgtgtcaaacgagaaaaggtccaagattccaagactgttcgcagattaactgatggtccaagaaggtcttacatgtcacaggcatcagcagtatccttggtttcttcttctacttccaatgaacagaaagatgaaggaaataagatcatgaagatagctagcccacagacaaataatgtgtgcccttctgtcgagcaaaggaaatcagagaatatttcaccattgaaggagccatgtgtaaggaatgagttgtcatgtacaacaaattctgatagtaacggattgcaatataatggaggacttggaggccataaaggatctgcaccaggcttgccagtttcttctagcccatcattttcttccaacgttgcaacaaggcccattagtacttcaagtgtatccatgaaaattgtgcaaggcttggtggcatctaaaagttgtatacaagcttcctctcgaactggagacagtagatcattgcttggtgagcatcataacagatcaccggcaatgattcatgatggaaccaacatgaagtccagtttggaaagctcaaacaattcttgcaggttgattgcatctgactataatgcaactccgtgtcattcatccaaggatcaggtattagtaacaccagggactaatgcctcagtagtgactctgaaagatagcagccaggtccatagtgcgtcaagtcagcagtttgtcagaactggcccatggacacaaagtgcttctcatgaagcatcatcacctagtacctctgctttgaagccttctttagatccccctgccatgaaaaatctgtatgggggttttactcaaggcagtgcccatcctggacctccaagtttcagtaatcagcaaccaaatgatgggcgtcttcaaagaacatctgaatctctaccaggtgtggaagctagagctaggggacatccaactgtcacggcacagcctgcactagaaattcacagcaggaatggaggtgcacagaagggtcctcgcatagccaatgttgtgcatcgtttcaagtgctctgttgaacctctcgaaattggtgttgtgctatcagggaggctgtggtcttcaagccaagcaatcttcccgaaagggtttagaagcagagtgaaatacttcagcattgtggatccaatccaaatggcatactacatatcggaaatactggatgctgggatgcaggggcctctgtttatggtaaaattagagaactgtccaggtgaagttttcattaacttatctccaaccaagtgttggaacatggtccgtgaaaggctgaacatggaaataaggaggcaacttaatatgggaaaatcaaatcttcctacattgcagcctccaggatcagttgatggtcttgaaatgtttggtttattatcaccaccaatagttcaggcaatttgggcgcgggacagagatcacatctgtacagagtactggagatcaaggccccatgttctcattgaggatccaaacaatcggcatatgttatctcagggtccacctctccttgccctgaggggtctcatccaaagggctaaccgggatgaattgcaagtcctgcggagtttgatgacgaacagcaacaatttggatgatagctccaggcaacaggccgcgcacattatcgaagaggagattgcgaagcaattgtgctga</cdnaseq>

Protein Sequence

<aaseq>MMGVTTTLNEDTEPSIPPGFGPFATLPLWGIHNDAKPAVTHSTP VQALQSIRKDSEECQPSAAVSRSDTPCSTSGTQTCRKSLRNRPPIDYSRFEHISDEDS DVEIVEKDVSSTRRRQQLPKGVLRGCAECSDCQKVIAKWNPAGARRPVLDEAPVFYPT EEEFEDTLKYIESIRPMAEPYGICRIVPPSSWKPPCLLKDKSIWEGSKFSTRVQKVDK LQNRKSSKKGRRGGMMKRRKLAESEENSATAHTQTGMQQSPERFGFEPGPEFTLQTFQ KYADDFSKQYFRKDTSMDSVPSVEDIEGEYWRIVEVPTEEIEVIYGADLETGTFGSGF PKLSPETKSDAEDKYAQSGWNLNNLPRLQGSVLSFEGGDISGVLVPWVYVGMCFSSFC WHVEDHHLYSLNYMHWGAPKLWYGVPGKDAVNLESAMRKHLPELFEEQPDLLHNLVTQ FSPSLLKSEGVHVYRCVQHEGEFVLTFPRAYHAGFNCGFNCAEAVNVAPIDWLPIGHN AVELYREQARKITISHDKLLLGAAREAIRAQWDILFLKRNTADNMRWKSICGADSTIF KALKARIETELVQRKTLGVPAQSRKMDAEFDSIDRECALCYYDLHLSASGCPCCPEKY ACLVHAKQLCSCDWDKRFFLFRYDVNELNILADALGGKLSAIHRWGVSDLGLSLSSCV KREKVQDSKTVRRLTDGPRRSYMSQASAVSLVSSSTSNEQKDEGNKIMKIASPQTNNV CPSVEQRKSENISPLKEPCVRNELSCTTNSDSNGLQYNGGLGGHKGSAPGLPVSSSPS FSSNVATRPISTSSVSMKIVQGLVASKSCIQASSRTGDSRSLLGEHHNRSPAMIHDGT NMKSSLESSNNSCRLIASDYNATPCHSSKDQVLVTPGTNASVVTLKDSSQVHSASSQQ FVRTGPWTQSASHEASSPSTSALKPSLDPPAMKNLYGGFTQGSAHPGPPSFSNQQPND GRLQRTSESLPGVEARARGHPTVTAQPALEIHSRNGGAQKGPRIANVVHRFKCSVEPL EIGVVLSGRLWSSSQAIFPKGFRSRVKYFSIVDPIQMAYYISEILDAGMQGPLFMVKL ENCPGEVFINLSPTKCWNMVRERLNMEIRRQLNMGKSNLPTLQPPGSVDGLEMFGLLS PPIVQAIWARDRDHICTEYWRSRPHVLIEDPNNRHMLSQGPPLLALRGLIQRANRDEL QVLRSLMTNSNNLDDSSRQQAAHIIEEEIAKQLC</aaseq>

Gene Sequence

<dnaseqindica>601..927#1029..1109#1194..1271#1377..1844#2196..2420#2545..2706#3256..3624#3704..5144#5352..5455#5534..5731#6029..6292#gtgcctgtgcttgtgcccaacaagaggagagcaaaatttcccctcgtcgtcagctcgctcgcctgcgccaccgccgaccccccatccatccctccccggcgacggcgaccggagcagaggggggttaggctcgccgccgccgccgccgccgccgcttctgctgcttctcccgccgccccgcatcgcatctatcccggtgagcatcccctacccacgcgctttttgccacgaatttgtagttgtagagagacctggaactggaagccctttttcctcttaatttgcccttaaccttgataatactaatagcaaaaaataataaaatagtaaaaaaaaattggggggttgaactgagctgaaccccccatgtctcatgtttagatctgtgcccctgatgtgcctgcctgctttggaacgatttcgttgtgagttgattccaatggtagatccatttcttcaagatgtgttgtgattttttttctcaaggttgtggatcaggatcatggcctaagccgtgaaatgcaatgaacttgacagattgaaccataagcaaaatttgttagctatcatggtgaaactaatttttcttctgatgcagtaatgatgggggttaccaccacgctcaacgaggacactgaaccctctattccacctggatttggaccttttgctacccttccgttatggggaatccacaatgatgccaaacctgctgttactcattctactcctgttcaagcattgcaaagcattagaaaagacagcgaagaatgccaacccagtgcggctgtgtctcggagtgatacaccttgcagcacttccggaacccagacatgcagaaaatcactgcgtaacagacccccaatagactatagccgctttgaacatatatcggatgaagattctgatgtcgaaatagtggaaaaggttggtactcatgaaagccgccactcttttgtcaacatttacctgacatttatacatgatgttaatgcttgccatggtattgctctattctttggacacaggatgtaagttcaacgagacgcagacaacagctaccgaaaggagtacttcgaggatgtgcagaatgcagtgactgtcaaaaggtttcaaatctattgccaaattgctatgctacttccttgatgatactgttgccttgcttgcttatttgactacatattattcaggttatcgcaaaatggaatccagctggtgcacgcaggcctgttcttgatgaggctcctgttttctatccaacagaggaggtacctttccccttgctaactgttgtactgtattgtatttagtactgtgatctttctgtatttatcgtcatatccccagatttgtgatattgtctcatggatcaggaatttgaagacactctaaaatacattgagagtatacggccaatggcggaaccatatggtatttgccgtattgtcccaccatcttcttggaagcctccatgccttcttaaagataaaagcatatgggaaggatcaaaattctctactcgggtacaaaaggttgacaagctccaaaaccgtaaatcatcaaaaaagggcagaagaggtggaatgatgaagaggagaaagcttgcagagtcagaggagaacagtgccactgctcacactcagacagggatgcagcaaagtccagagagatttggatttgaacctgggccagagttcacgttacagacatttcagaaatatgcagatgatttcagtaagcagtactttaggaaagatacatcgatggattcagtaccatcagtggaagatattgaaggtgagtactggcgcatcgttgaggttcccacagaagagatagaggtactgagcttctgttgactctcaacaaattatactgacgtgcttgcaatttatacctcagttgaactttgaaaattttatcaattcctaatttttggatatgtggtctctggtctcggattatggccctgctggagagtttctaaataagttatggattgccttgctgtatatgctatcatgacctccaaaaattagtgctacttttacatagccatatcatttgtagatgagacattttaggcctaactgtattgctgtaactgcataaatgttgtatcatgtaggatagtttccgtacaactactgttgtttttccgtacttatcagaagatgtgatatattatgtaggtgatatatggtgctgatctggagactggaactttcggcagtggttttccaaaattatctcctgagacaaaatctgatgctgaggataaatatgcacaatctggttggaatctaaataacttgcctagactacaaggttcagttctttctttcgagggcggtgacatttctggtgttctagtgccttgggtgtatgttggcatgtgtttttcatcattctgctgggtaagatgcttgtgatattgcttgtcatgactttctgttctagttgtgcttcttgattcttttttttcccgaaactatccaacctgagatttgttacactcaattgtgttatgtctactaacagcatgttgaagaccatcatttatactcactaaactacatgcattggggtgccccaaagttgtggtatggagttccaggaaaggatgctgtgaatttggaatctgcaatgaggaaacatctacctgaattatttgaggagcaacctgatttgctacacaaccttgtgagtatcttgattggcagttttctgtttgtgcccaggaaggaagccttttgtatctagtaacaactaatgctcgatagactctgtgatagcagtgaatactgggagctacttataatcatgccacatgaaatgcatttttggaagttataagaaatagataattttctaaccttctgtacaaaagaaggtatatttttgtaacatcattttcctactgcattattgttatggtagtatgccagcaaccaataacttttcaattctctctattttccaatcactactaaatcatctaactttagacatctttataacgcaagactcagcaagagctcaccatgtgtaaaacagcaccaacacattaactattcatgtggtagtaaagaaatggtttgtctgagtgtctaaagcattatgttctattctttgaatttagacataagatttttaaaaaaaatgatgtgagcacttatatatgggttgtgtttgctatgatgtgtatgagcagcatttttatgtgttttgttatgacaacctctaccgcaggttacccagttttcaccatcgctgctgaaatctgaaggagtacatgtataccgttgtgttcagcatgagggcgagtttgtcttgacattcccaagggcgtaccatgctggtttcaattgtggcttcaattgtgccgaagctgttaatgtggctcctattgattggttaccgattggacataatgctgtagagctttatcgtgagcaagctaggaaaataaccatttctcatgataagttgttgttgggggctgcaagagaagcaataagagctcagtgggatatcctattcctcaagaggaatactgctgataatatgaggtggaagagtatatgcggagctgatagcactatattcaaggctcttaaggtaaagtccaattaaaatatgtgttgtattgtttgtttaagaactcaatggaagctcatacttaaaattctctgtttaggcacgaattgagacagagttggtgcaaaggaaaactctaggtgttccagctcaatcaaggaaaatggatgctgaattcgattccattgatagggaatgtgccttgtgctactatgatttacatctttctgcttctggctgtccatgctgcccagagaaatatgcttgccttgtacatgcaaagcaactttgctcatgtgactgggacaaaaggtttttcctattccgctatgatgtcaatgagctaaatatcttagctgatgctttaggggggaaattaagtgccattcatagatggggcgtctctgatcttggattaagtttgagttcatgtgtcaaacgagaaaaggtccaagattccaagactgttcgcagattaactgatggtccaagaaggtcttacatgtcacaggcatcagcagtatccttggtttcttcttctacttccaatgaacagaaagatgaaggaaataagatcatgaagatagctagcccacagacaaataatgtgtgcccttctgtcgagcaaaggaaatcagagaatatttcaccattgaaggagccatgtgtaaggaatgagttgtcatgtacaacaaattctgatagtaacggattgcaatataatggaggacttggaggccataaaggatctgcaccaggcttgccagtttcttctagcccatcattttcttccaacgttgcaacaaggcccattagtacttcaagtgtatccatgaaaattgtgcaaggcttggtggcatctaaaagttgtatacaagcttcctctcgaactggagacagtagatcattgcttggtgagcatcataacagatcaccggcaatgattcatgatggaaccaacatgaagtccagtttggaaagctcaaacaattcttgcaggttgattgcatctgactataatgcaactccgtgtcattcatccaaggatcaggtattagtaacaccagggactaatgcctcagtagtgactctgaaagatagcagccaggtccatagtgcgtcaagtcagcagtttgtcagaactggcccatggacacaaagtgcttctcatgaagcatcatcacctagtacctctgctttgaagccttctttagatccccctgccatgaaaaatctgtatgggggttttactcaaggcagtgcccatcctggacctccaagtttcagtaatcagcaaccaaatgatgggcgtcttcaaagaacatctgaatctctaccaggtgtggaagctagagctaggggacatccaactgtcacggcacagcctgcactagaaattcacagcaggaatggaggtgcacagaagggtcctcgcatagccaatgttgtgcatcgtttcaagtgctctgttgaacctctcgaaattggtgttgtgctatcagggaggctgtggtcttcaagccaagcaatcttcccgaaaggtttgcattttgacagatcattggcagtacctcaataaatttagtgtttaggtcaaagaatttctgttatccgggagcttagtgttatgtctttgcatccatgaattttgctgtctttgatctatggtagttatactctatagtaattctgctgttgttttctgaatggctgtactcacaaatgttacactctctttgtaaatgcagggtttagaagcagagtgaaatacttcagcattgtggatccaatccaaatggcatactacatatcggaaatactggatgctgggatgcaggggcctctgtttatggtaaatttaagtttctcagctgtctttatgtatctgtcttagcatctgtacatattattgctcatttcatttttgcaggtaaaattagagaactgtccaggtgaagttttcattaacttatctccaaccaagtgttggaacatggtccgtgaaaggctgaacatggaaataaggaggcaacttaatatgggaaaatcaaatcttcctacattgcagcctccaggatcagttgatggtcttgaaatgtttggtttattatcaccaccaatagttcaggtgagacattaatgtctggtatcctcatgattgatctctaaggcctgtattggcattgcgaggccctttttataatagtgatttatgcacttataagtgaaaggaaatatatattagtatttcgaagtatttcatctcttttaagattccttaagatggcatgaatgactggagtaactagccctgctgcaggcttacatgctaagcttgttaattaagcatgtagttgattacctgtagctttggtctgtcaagttgatttgttggagccaatctttgacactgcaacttaaacaggcaatttgggcgcgggacagagatcacatctgtacagagtactggagatcaaggccccatgttctcattgaggatccaaacaatcggcatatgttatctcagggtccacctctccttgccctgaggggtctcatccaaagggctaaccgggatgaattgcaagtcctgcggagtttgatgacgaacagcaacaatttggatgatagctccaggcaacaggccgcgcacattatcgaagaggagattgcgaagcaattgtgctgagaagggtaaataccggctggctgttgtactttagatggcatgaatatttttttttccgacagggttaagcagatctaaaaccgaggcttgcttctccccttgcctttcatgcccattctttccattcttgagcccataccataagatttatgcttcaggtgactgttgtttcattgactgacttgtgtacatacagatgtgttgtgttcctaaatgctagccagctgcctcatctttcctgtaaaactcatgttgtgttcagctgtccagttaagtagggttgcttctagttcagagatctttggacagtcaaaatgtccatgccagatgtatctgctatgttattactttccagtctaacagtgattttgtgctgctgctagcaggcactcgagttttc</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0196500, RefSeq:Os05g0196500