Difference between revisions of "Os02g0724000"

From RiceWiki
Jump to: navigation, search
(Evolution)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
DTH2 behaves as a single Mendelian factor,it encodes a CONSTANS-like protein that promotes heading by inducing theflorigen genes Heading date 3a and RICE FLOWERING LOCUS T 1, and it acts independently of the known floral integrators Heading date 1 and Early heading date 1.DTH2 likely represents a target of human selection for adaptation to LD conditions during rice domestication and/or improvement, demonstrating an important role of minor-effect quantitative trait loci in crop adaptation and breeding.[1]
+
DTH2 behaves as a single Mendelian factor,it encodes a CONSTANS-like protein that promotes heading by inducing theflorigen genes Heading date 3a and RICE FLOWERING LOCUS T 1, and it acts independently of the known floral integrators Heading date 1 and Early heading date 1.DTH2 likely represents a target of human selection for adaptation to LD conditions during rice domestication and/or improvement, demonstrating an important role of minor-effect quantitative trait loci in crop adaptation and breeding.<ref name="ref1" />
  
 
===Expression===
 
===Expression===
DTH2 transcripts were detected in all tissues examined,but its expression was most abundant in leaf blade and sheath,it is also found that DTH2 expression is controlled by the circadian clock [1]
+
DTH2 transcripts were detected in all tissues examined,but its expression was most abundant in leaf blade and sheath,it is also found that DTH2 expression is controlled by the circadian clock <ref name="ref1" />
  
 
===Evolution===
 
===Evolution===
Research indicates that A4 allele of DHT2 may have undergone intensive selection during the northward expansion ofjaponicarice to NLD conditions in Asia.Another assay finds that the diversity at the genes surrounding DTH2 in japonica is reduced.It can be explained by the combination of domestication bottleneck and selective sweep around DTH2, providing additional evidence that DTH2 has been subjected to artificial selection during domestication or improvement ofjaponica rice.[1]
+
Research indicates that A4 allele of DHT2 may have undergone intensive selection during the northward expansion ofjaponicarice to NLD conditions in Asia.Another assay finds that the diversity at the genes surrounding DTH2 in japonica is reduced.It can be explained by the combination of domestication bottleneck and selective sweep around DTH2, providing additional evidence that DTH2 has been subjected to artificial selection during domestication or improvement ofjaponica rice.<ref name="ref1" />
  
 
==Labs working on this gene==
 
==Labs working on this gene==
 
[1]National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University,Nanjing 210095, China
 
[1]National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University,Nanjing 210095, China
 +
 
[2]National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Sciences, Chinese Academy of Agricultural Sciences, Beijing 100081, China
 
[2]National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Sciences, Chinese Academy of Agricultural Sciences, Beijing 100081, China
 +
 
[3]State Key Laboratory of Systematic and Evolutionary Botany, Institute of Botany, Chinese Academy of Sciences,Beijing 100093, China
 
[3]State Key Laboratory of Systematic and Evolutionary Botany, Institute of Botany, Chinese Academy of Sciences,Beijing 100093, China
  
 
==References==
 
==References==
[1]Wu W, Zheng XM, Lu G, Zhong Z, Gao H, Chen L, Wu C, Wang HJ, Wang Q, Zhou K,Wang JL, Wu F, Zhang X, Guo X, Cheng Z, Lei C, Lin Q, Jiang L, Wang H, Ge S, Wan  
+
<references>
 +
<ref name="ref1">
 +
Wu W, Zheng XM, Lu G, Zhong Z, Gao H, Chen L, Wu C, Wang HJ, Wang Q, Zhou K,Wang JL, Wu F, Zhang X, Guo X, Cheng Z, Lei C, Lin Q, Jiang L, Wang H, Ge S, Wan  
 
J. Association of functional nucleotide polymorphisms at DTH2 with the northward expansion of rice cultivation in Asia. Proc Natl Acad Sci U S A. 2013 Feb
 
J. Association of functional nucleotide polymorphisms at DTH2 with the northward expansion of rice cultivation in Asia. Proc Natl Acad Sci U S A. 2013 Feb
 
19;110(8):2775-80. doi: 10.1073/pnas.1213962110. Epub 2013 Feb 6. PubMed PMID:23388640; PubMed Central PMCID: PMC3581972.
 
19;110(8):2775-80. doi: 10.1073/pnas.1213962110. Epub 2013 Feb 6. PubMed PMID:23388640; PubMed Central PMCID: PMC3581972.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 15:12, 31 May 2014

Please input one-sentence summary here.

Annotated Information

Function

DTH2 behaves as a single Mendelian factor,it encodes a CONSTANS-like protein that promotes heading by inducing theflorigen genes Heading date 3a and RICE FLOWERING LOCUS T 1, and it acts independently of the known floral integrators Heading date 1 and Early heading date 1.DTH2 likely represents a target of human selection for adaptation to LD conditions during rice domestication and/or improvement, demonstrating an important role of minor-effect quantitative trait loci in crop adaptation and breeding.[1]

Expression

DTH2 transcripts were detected in all tissues examined,but its expression was most abundant in leaf blade and sheath,it is also found that DTH2 expression is controlled by the circadian clock [1]

Evolution

Research indicates that A4 allele of DHT2 may have undergone intensive selection during the northward expansion ofjaponicarice to NLD conditions in Asia.Another assay finds that the diversity at the genes surrounding DTH2 in japonica is reduced.It can be explained by the combination of domestication bottleneck and selective sweep around DTH2, providing additional evidence that DTH2 has been subjected to artificial selection during domestication or improvement ofjaponica rice.[1]

Labs working on this gene

[1]National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University,Nanjing 210095, China

[2]National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Sciences, Chinese Academy of Agricultural Sciences, Beijing 100081, China

[3]State Key Laboratory of Systematic and Evolutionary Botany, Institute of Botany, Chinese Academy of Sciences,Beijing 100093, China

References

  1. 1.0 1.1 1.2 Wu W, Zheng XM, Lu G, Zhong Z, Gao H, Chen L, Wu C, Wang HJ, Wang Q, Zhou K,Wang JL, Wu F, Zhang X, Guo X, Cheng Z, Lei C, Lin Q, Jiang L, Wang H, Ge S, Wan J. Association of functional nucleotide polymorphisms at DTH2 with the northward expansion of rice cultivation in Asia. Proc Natl Acad Sci U S A. 2013 Feb 19;110(8):2775-80. doi: 10.1073/pnas.1213962110. Epub 2013 Feb 6. PubMed PMID:23388640; PubMed Central PMCID: PMC3581972.

Structured Information

Gene Name

Os02g0724000

Description

Zinc finger, B-box domain containing protein

Version

NM_001054510.1 GI:115448390 GeneID:4330574

Length

4797 bp

Definition

Oryza sativa Japonica Group Os02g0724000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:30981208..30986004

Sequence Coding Region

30983167..30983754,30984251..30984451,30984722..30985026,30985312..30985441

Expression

GEO Profiles:Os02g0724000

Genome Context

<gbrowseImage1> name=NC_008395:30981208..30986004 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:30981208..30986004 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggatgctctttgtgatttctgcagggagcaaaggtcaatggtctattgccgatcagatgcagcatccttgtgcttgtcgtgtgatcgtaatgtgcattcagccaatgccctttcccgacgccatacaagaacccttctttgtgatcgttgtgttggacagcctgcagcagtccgttgtcttgaagagaacacctcactttgccaaaactgtgactggaatggacatggggcagcatcctcagctgctgggcataaaaggcagaccataaactgttactcggggtgcccatcgtcggcagagctctcgagaatctggtcctttagtatggatatcccaactgtagctgcggagccaaactgtgaggaaggaataaacatgatgagcattaatgacaatgacgtcaataaccattgtggtgctccagaagatggccgcttgttggatatagctagcacagcactcatgagtgatttacctacaggagacaagttcaaacctttaataggttcttcttcaggagatgggatgaatcttctgccacttaattcagatcagccagctgagccagtttcaacgacgcctaaggcaccctgtgtcacagacaaagatatgttcaatgatgggagcgtatatggagacttctgtgtggatgatgctgacctaacatttgagaattatgaagaattattcggtacctctcacgttcaaacagaacaactctttgatgatgctggaattgacagttattttgaaatgaaggatgtgccagcagatgaatctaatgagcagcccaaacctgtgcagccagaatgtagcaatgtcgcatctgttgattctgggatgtcaaacccagctgcaagggctgattccagccattgtattcctggtaggcaggctatatccaacatatccctttccttctctggtttgactggtgaaagcagtgctggatattttcaagattgtggggtatcgtcaatgatccttatgggtgagccaccctggcatcctcctggtcctgaaagttcatctgctggaggcagcagagataatgctcttacacggtacaaggagaagaagaagagaagaaaatttgacaagaagataaggtatgcttctcgtaaggctagggcagatgtgagaaaaagggtcaaaggacggtttgtaaaggctggcgaagcatatgactacgatccgctgagccaaacaagaagctactaa</cdnaseq>

Protein Sequence

<aaseq>MDALCDFCREQRSMVYCRSDAASLCLSCDRNVHSANALSRRHTR TLLCDRCVGQPAAVRCLEENTSLCQNCDWNGHGAASSAAGHKRQTINCYSGCPSSAEL SRIWSFSMDIPTVAAEPNCEEGINMMSINDNDVNNHCGAPEDGRLLDIASTALMSDLP TGDKFKPLIGSSSGDGMNLLPLNSDQPAEPVSTTPKAPCVTDKDMFNDGSVYGDFCVD DADLTFENYEELFGTSHVQTEQLFDDAGIDSYFEMKDVPADESNEQPKPVQPECSNVA SVDSGMSNPAARADSSHCIPGRQAISNISLSFSGLTGESSAGYFQDCGVSSMILMGEP PWHPPGPESSSAGGSRDNALTRYKEKKKRRKFDKKIRYASRKARADVRKRVKGRFVKA GEAYDYDPLSQTRSY</aaseq>

Gene Sequence

<dnaseqindica>1960..2547#3044..3244#3515..3819#4105..4234#cgctcgctctccctttcgcgcaccagaaaagtcgttttttaattttcgagtttccgtggaagattctcgatacctgtccctcgtcgtcgtcctcctccgccggccgccgccgacgaccgcagcaggggtggatccggggcggcgccgattcggtgagtccggtctcgcgagctcgagctgtttgtttgtttgtttgtttggtggggattggattgggttggatttgcgttgtgtaggctagccgcatcagcgccgcttgtttggtggatttcgtgagctgctgctggattagggggctgggattgggattgggaggggggatggatcatggatgtcggtggattgggggggattgggtttgagtgttcgatttcgagtccgcttgatcgtttctgtggtgttccagggtgtttggtgttggggagtctgaactgattttttggttttctttctttttgcggacacttcacgctttctctcgtgttgcgtggagcgtacgtgagtggtttttggtccggctttagctttgagctggactttagctgctcagaatttgattatttttctttctctaattggagtacatacaagtacgatggcttagcatgtttcagtatccagttcagttttcaactagaaaatattaacaatttcatcccctctgcccttttgtctactgacataatagtcgtgtagcggcaactgcggttagatgcagaaaggaagcccttttgtattcttaaatttggataatcttaaaaaacaaaataacatttctcttgcttatttgagtggctcagaaagtttgttgcttttatccacacacggcatgctttatatgatcagagaagtggggttagtgctatttaaaacttaggattagtcccgataaaattgtttgtattgtggagatgcatgcttgttgatttacatgattagtgctcagaaaaggtgcccttttgatatgcaaaataggacataccagcgtcaaaaataaagggacataataaaatgagcaaccaggatcattgttggatgcacagctggtgaagtcctatttgtattgccgcttctagctcttgcccatgcatgctaataagccatcccatgctggtacgaaaagtgacttttattaactcagaaatgctatcaactgcagctagcatttgtttgctgcatagctccatgttgctaatttcatgtttttccattgttatcagatgcattgtactgctctctgctagacttgtctagtgaattggtgttattgacccttattttttaaacatggatacttttttcccccttatatgctttacagagaacatgcgcttacaggttacagactgacagtacataggatagaagataaaaccgtaacatttaccaagaaaaacttcctgcaagtagttttgtgcccttctatttcagagacttttgagttctttatgcccttgctagcaaatcttgggtgggataataaaactcaaaactcttcacaaattgttatacgctacctatattttaaattgttactaagtcaatgaatatattgattgctcttgttgtgatacatttgaaatgtttctgttggttgcagagcaattcaagtggttcatttcatggcctgtatcaatatacttatatatctccaacacttaccaaggaatggaaacaaactcatcatgtaacatgggctgcaaaatctgtcccttcttttctaatttgaagtgtgcacatatttgctatattttccattaaaaaaatatactactctctttccataatgttcaattataagtttgttgttttgttgttactgatttttgtttttggctttttgcacaccagtatcctggtaggatcccactgaattcaactgttgaacaaaaagccaggaaggtggctgttcttgtggcactcagtgctagtggaagtgctccagtactgtacaggaccatggatgctctttgtgatttctgcagggagcaaaggtcaatggtctattgccgatcagatgcagcatccttgtgcttgtcgtgtgatcgtaatgtgcattcagccaatgccctttcccgacgccatacaagaacccttctttgtgatcgttgtgttggacagcctgcagcagtccgttgtcttgaagagaacacctcactttgccaaaactgtgactggaatggacatggggcagcatcctcagctgctgggcataaaaggcagaccataaactgttactcggggtgcccatcgtcggcagagctctcgagaatctggtcctttagtatggatatcccaactgtagctgcggagccaaactgtgaggaaggaataaacatgatgagcattaatgacaatgacgtcaataaccattgtggtgctccagaagatggccgcttgttggatatagctagcacagcactcatgagtgatttacctacaggagacaagttcaaacctttaataggttcttcttcaggagatgggatgaatcttctgccacttaattcagatcagccagctgagccagtttcaacgacgcctaaggtgcatgcttctcattcccctccaaaacctattcaagtattctgctaagtttctgcataggtcataacatattgcatggacatattattacaccaaatgttcacactgcgtggttgcggtttcgaccatgtactttgttttggtattcttctagaagtgaacgttcgaagggaaaactttctgtagtttgaccaatggtacaatgaccatcttttggtcattatttattactgtttgctactttcttaagagttccacactgtcaaagctttcctggtgtttttctcctgccgagcaagttactcttatcttctaataattttaccattgaatgtgaattcacctagatcttataattccctaatgatgatggttgaacaattgctgcagttggaatttgtgtatttccaatatcattattcatgaaaatgtcatctgcgatgcctgtcattatggtgtcactgcgtgcttatcgaaacttggttgcataattcaggcaccctgtgtcacagacaaagatatgttcaatgatgggagcgtatatggagacttctgtgtggatgatgctgacctaacatttgagaattatgaagaattattcggtacctctcacgttcaaacagaacaactctttgatgatgctggaattgacagttattttgaaatgaaggatgtgccagcagatgaatctaatgaggtccgtacctttctgcatatagtctttttatctgctgtgtttgttgtaggaaaagagctctgttttgctatttctgaccttcccgccataatcagggttaatctcgttttcctccatttgtgcttatatcgagttgaccctaccattttactgagaatcattaaatgattgattgggttaattaggagtggaatgtctgcatatctcatcgtccattttatggctattaattattttactaaaattttggtatgactgttatactttcagcagcccaaacctgtgcagccagaatgtagcaatgtcgcatctgttgattctgggatgtcaaacccagctgcaagggctgattccagccattgtattcctggtaggcaggctatatccaacatatccctttccttctctggtttgactggtgaaagcagtgctggatattttcaagattgtggggtatcgtcaatgatccttatgggtgagccaccctggcatcctcctggtcctgaaagttcatctgctggaggcagcagagataatgctcttacacggtacaaggagaagaagaagagaagaaagtaagtgcatcttactgtgctttttcagttttttgaaagtaagttcatactagtacttgatatgccatggttaaatgcattacagctaagaatgtggctgcagtatcattcaattttcagatttggaattctatattaaaaagcttactgtgccaaatcgatattttcgtatacacgtgatcattttagacatgtggatgcttgctcctagtgtgaatgctactttatgtttttcttaaaagaagttattatatggcctttcttcacatattttcttcttaacagatttgacaagaagataaggtatgcttctcgtaaggctagggcagatgtgagaaaaagggtcaaaggacggtttgtaaaggctggcgaagcatatgactacgatccgctgagccaaacaagaagctactaaagcctttcactcgattggtttcgtccagtgttcaagtagcaattttcagcagctgatttgatgttggttgcacggcaagcatgatcactggagaacacaagcaattgcggcagaccttgcaattgaaaacggggaaaggaaaccaaacgctgtgatcaaatcaaattaatgaaataaaaaaggaaaaaataggatgcaaacatgcgagaagctcatggatggtaatgctccattttctcctgtacagttcatgcatcttcagttgcttctggttgagatgtctgaatcactctctaccatctgtgcattaatcaaatacaaatacatgggcctaccgcacgacgacgaacgcacctgcttctgttgtgatgttttgtgttgcggctgtcaggctggatctctaggtaacatgattaattatactactgatggaatttgcaccgctgtaatattatttacgaatcacaatctgccgtgggattgttcttctgtcgtgtatgtatgtgtatatagatggatggctgttaagaaaatattgtgacgattataaagtttacctttgt</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0724000, RefSeq:Os02g0724000