Difference between revisions of "Os04g0653000"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Mutation and Phenotype)
Line 19: Line 19:
 
===Mutation and Phenotype===
 
===Mutation and Phenotype===
 
Please input information here.
 
Please input information here.
 +
 +
The EG2 gene was mapped to chromosome 4 between CQQ2 and CQQ3, two In-Del markers that define a 2.2 cM.
 +
 +
[[File:eg-2.jpg]]
 +
 +
The mutation of EG2 is eg2-1D, which caused by C-to-G transition, resulting in a substitution of Ala by Gly in the fifth amino acid of the Jas domain. This motif  was known to be critical for JAZ’s interaction with the JA receptor COI1.
 +
 +
[[File:eg-3.jpg]]
 +
 +
mutants displayed defects in spikelet development,including extra glume-like structures between the sterile lemma and lemma and altered floral organ numbers and identities.
 +
 +
[[File:eg-4.jpg]][[File:eg-5.jpg]]
  
 
===Evolution===
 
===Evolution===

Revision as of 08:00, 4 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

  • EG2(extra glume 2)is a JA signalling repressor that interacts with a putative JA receptor, OsCOI1b, to trigger OsJAZ1’s degradation during spikelet development[1].
  • Its high sequence similarity with the Arabidopsis JAZ proteins so also called OsJAZ1[1].
  • It belong to TIFY family so also called TIFY family[2].

Expression

Please input expression information here.

EG2 expressed ubiquitously in the plant, from roots, stems and leaves, to spikelets and seeds. Eg-1.jpg

Mutation and Phenotype

Please input information here.

The EG2 gene was mapped to chromosome 4 between CQQ2 and CQQ3, two In-Del markers that define a 2.2 cM.

Eg-2.jpg

The mutation of EG2 is eg2-1D, which caused by C-to-G transition, resulting in a substitution of Ala by Gly in the fifth amino acid of the Jas domain. This motif was known to be critical for JAZ’s interaction with the JA receptor COI1.

Eg-3.jpg

mutants displayed defects in spikelet development,including extra glume-like structures between the sterile lemma and lemma and altered floral organ numbers and identities.

Eg-4.jpgEg-5.jpg

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os04g0653000

Description

The start codon is not identified.

Version

NM_001060638.1 GI:115461005 GeneID:4337240

Length

3445 bp

Definition

Oryza sativa Japonica Group Os04g0653000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:33705210..33708654

Sequence Coding Region

33705211..33705317,33707373..33707475,33707567..33707792,33707906..33707963,33708275..33708365

Expression

GEO Profiles:Os04g0653000

Genome Context

<gbrowseImage1> name=NC_008397:33705210..33708654 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:33705210..33708654 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>ggagaggagaggaaggaggaagaggtggtggtggaggagaagagccatcagcagcagcagcagcaaggggaggaggagctcgtcggcctctcgctcgccggcggcaggcccaaagtatttccaatgtcgagccctccacctaatccttcgcaacttacaattttctatggtggatcagtatgtgtttatgactcagtgccgccagagaaggctcaagcaatcatgcttattgccgcagcagctgctgcagcggcgtctgccaccaaaagcaatgctgccattgctgttaagccccctgtgatgcctgcagccaatgctacccaagcagcagtctctcctgtgctcacaagatcgctctcattgcagagcacttctgtagcaactggacaacctcaagttgccgctgaccctagctcaatttgcaagctccaggctgatctccccattgccaggaggcactcccttcagcgcttcctagagaaacgccgtgacaggttggtgagcaaagctccatatcccacaaaatcctccgagggcatggaagcatcagggatggaagtaactgctgagggcaaggcccagtaa</cdnaseq>

Protein Sequence

<aaseq>GEERKEEEVVVEEKSHQQQQQQGEEELVGLSLAGGRPKVFPMSS PPPNPSQLTIFYGGSVCVYDSVPPEKAQAIMLIAAAAAAAASATKSNAAIAVKPPVMP AANATQAAVSPVLTRSLSLQSTSVATGQPQVAADPSSICKLQADLPIARRHSLQRFLE KRRDRLVSKAPYPTKSSEGMEASGMEVTAEGKAQ</aaseq>

Gene Sequence

<dnaseqindica>2..108#2164..2266#2358..2583#2697..2754#3066..3156#gggagaggagaggaaggaggaagaggtggtggtggaggagaagagccatcagcagcagcagcagcaaggggaggaggagctcgtcggcctctcgctcgccggcggcaggtagttttccggctccgccttctcctctcgcaagtcgagtcctattcagctttgggttgatcgattgggtcgcgggagagagagtatttggttggttgttcgggaaatgcatctcgcgcgggattctagccgcttttcagttcatagtatcgccccttctccgagaactcgccgccggggagccgcttcctgctgggagccgagcggcgccgcagccgcctccgaagtggtttaccggaggggatggattttctccggtactggactcctggtgtttgaatttttgggtggaaccggagactctttttttggtcgggtgaaattccttggaccgaccaaaaaaatctcgaatccactcggagtttcctccgttccagatggagctcttgcgttgaaaattttcctaaaaatagagtcaaaatgtttcgacttcgagttaagagtccaccctacaccgagttgcaactttcccttttttacgagttggtgtaatcatggaagagcccttagctttgctgcagtggatcaaattggtgggggttcttgcctaggtcatgtgaagattcttctgattagtggtagtctcatgcttctcctcggcctgcaatccaaatcccctttattcctttcccgctctcttgcgcttggcgtcagctgttcttaaccttgaacaaattagggtgtcattctagttgcacgtgttcttatccagatgttgggagtgcggtgaactgctgatattctactaaaccgatatcaattatatggatgttcaatttggttcacgtcactaggtaaatgatttcccaccttagaccaaacttaacggataggaaagaacttttggcaagtggcagatccaggtagtttttttccttccctttttctgtaattggcagttacttgttctccaaatacttggaactgctgtgaaaagtttccaattgagccttggaatcaggagcaatggggaactcttctaagttacttgcatttcttctttaaagactcagaaataataagcaagaaacacacatagatctggtgaaacttgagttagcgtgcagtttttaacacctccatgtaccaaggggattcaatggtaaaggcctcatccccttgtcttatctttacttcaagactaaatctgtagctggggaccaagtaccatagtttcgcaactcttatataatccactaggctgctgtgaaaacaatagatgcagtgtttgttttgaagtaagtaaggtgaaagtaaaaatacctggtaatggctaatatgaatcgtggctattattaaatgtttcagcattttctgaataggtaaaccacatatatgtaactatgtaagatgtttttaaatctagatgttctattgagcctgtaacctggtcttttagactagattatgctgagactttgaagaaaaaaatttcagtacattccgtccatcttggacaacctttggacagattattaactctgaatcagtcccatcatgctgcacatgttggatatttcagagtggaccataaagttgcaggcctagtttgctatttttagattttagatcttgtgagttttaatcttgatcatgctattagactcagaatgtgtgtaccaaaaacattgataatggtatctatcctgacttgggtataacttgtgttactggcagctgtgggagggctatgttggcgtagcgtactgaccaagagataatcctctcatcaagtagaatatagagagtagaataattatttatgaaggagatgggcctttatctggctgcagacaaggtgcatagtaaagctcattaaacctctaaaaaaggctggaaatacggcctacggtgtaattgcacattatacatcagttagctaggttggcctccaattttatatggcactttacccttggatgcccatcttatgtattgccatgtactcatgtatgcaattagtcaagaacggcccacttatgccaatatctgtgtaactatgcaatctgttattaccttcttgcacatttactaatttcgctttgtcataatcaggcccaaagtatttccaatgtcgagccctccacctaatccttcgcaacttacaattttctatggtggatcagtatgtgtttatgactcagtgccgccagagaaggtcatattcaccccacttatcttcgttatatcctccgactaactgttgaaagtttatgctaattcgttatctgcaacattgtcatcaacaggctcaagcaatcatgcttattgccgcagcagctgctgcagcggcgtctgccaccaaaagcaatgctgccattgctgttaagccccctgtgatgcctgcagccaatgctacccaagcagcagtctctcctgtgctcacaagatcgctctcattgcagagcacttctgtagcaactggacaacctcaagttgccgctgaccctagctcaatttgcaagctccaggctggtaagactacaagatctttttgtgaatctaaaatggggctgttttaatccctcgtcatatgatgtactaagtgattgaagatgctacaaatttattctttatttgctgtgcagatctccccattgccaggaggcactcccttcagcgcttcctagagaaacgccgtgacaggttggcatgaatgaatgtagaaatagcattctatatttgtctgatgcatttccttaggtttagtggtccattagaacatgctaaaagaatgtggatagctggaaactgacttgtaggggataaaacatttgctttagcttgacttggatacgaaccaagtatatgtgcaaggactgttttcagtttcattaccatagcccatgttttcatgatacataacaaagtagccagtagttatagaaacacagctttctgcaaatttgagaaatccttagcttcaactgattaagccaaatgaccatgttaagcaggttggtgagcaaagctccatatcccacaaaatcctccgagggcatggaagcatcagggatggaagtaactgctgagggcaaggcccagtaactgtcaacttcgaatggtggaggctgacgtttggagggggaaggaaggaaaggcgtcgcgttcattgtttagatggtgtcgcaccctagaaccttactaataatcgaacctatgcccttattatcgttgtactgttccttatgtgctagtctattctgtcatgaatttgtttactcgaacagcaaactgctatgatagtagtatatcattgtacatcatgcatatcattgcctgacaatgttatcgtgttcgtctagtaatgatatcatccaggttaattgttactagt</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0653000, RefSeq:Os04g0653000