Difference between revisions of "Os04g0653000"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(EG2 is a repressor of JA response)
Line 35: Line 35:
 
Please input information here.
 
Please input information here.
  
You can also add sub-section(s) at will.
+
yeast two-hybrid (Y2H) assays show OsJAZ1 can interact with OsCOI1b, and the interaction was dependent on JA-Ile’s mimic, coronatine(COR), but not JA or MeJA. No interaction was observed between OsJAZ1 and OsCOI1a or OsCOI1c.
 +
 
 +
[[File:eg-6.jpg]]
 +
 
 +
Furthermore, the Ala-to-Gly mutation in the Jas domain of OsJAZ1 in eg2-1D blocked the interact between OsJAZ1 and JOsCOI1b, suggesting that the Jas domain is required for the interaction between OsJAZ1 and OsCOI1b. because  osjaz1-1D can't interact with OsCOI1b, so it can't be JA-dependent proteasome-mediated degradation.
 +
 
 +
 
 +
[[File:eg-7.jpg]]
 +
 
 +
JA regulates early spikelet development possibly by activating the expression of OsMADS1 through OsMYC2, which is directly regulates OsMADS1 expression.And, OsJAZ1 interacts with OsMYC2 and suppresses the activity of OsMYC2 in triggering the transcription of OsMADS1.Both OsJAZ1 and osjaz1-1D interacted with OsMYC2, and the interaction required the Jas domain.
 +
 
 +
[[File:eg-8.jpg]]
 +
 
 +
Inconclude,eg2-1D can't interact with OsCOI1b, so it not degradation, but it also can interact with OsMYC2 to block  OsMYC2 regulates the OsMADS1 expression.
 +
 
 +
[[File:eg-9.jpg]]
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 08:23, 4 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

  • EG2(extra glume 2)is a JA signalling repressor that interacts with a putative JA receptor, OsCOI1b, to trigger OsJAZ1’s degradation during spikelet development[1].
  • Its high sequence similarity with the Arabidopsis JAZ proteins so also called OsJAZ1[1].
  • It belong to TIFY family so also called TIFY family[2].

Expression

Please input expression information here.

EG2 expressed ubiquitously in the plant, from roots, stems and leaves, to spikelets and seeds. Eg-1.jpg

Mutation and Phenotype

Please input information here.

The EG2 gene was mapped to chromosome 4 between CQQ2 and CQQ3, two In-Del markers that define a 2.2 cM.

Eg-2.jpg

The mutation of EG2 is eg2-1D, which caused by C-to-G transition, resulting in a substitution of Ala by Gly in the fifth amino acid of the Jas domain. This motif was known to be critical for JAZ’s interaction with the JA receptor COI1.

Eg-3.jpg

mutants displayed defects in spikelet development,including extra glume-like structures between the sterile lemma and lemma and altered floral organ numbers and identities.

Eg-4.jpgEg-5.jpg

EG2 is a repressor of JA response

Please input information here.

yeast two-hybrid (Y2H) assays show OsJAZ1 can interact with OsCOI1b, and the interaction was dependent on JA-Ile’s mimic, coronatine(COR), but not JA or MeJA. No interaction was observed between OsJAZ1 and OsCOI1a or OsCOI1c.

Eg-6.jpg

Furthermore, the Ala-to-Gly mutation in the Jas domain of OsJAZ1 in eg2-1D blocked the interact between OsJAZ1 and JOsCOI1b, suggesting that the Jas domain is required for the interaction between OsJAZ1 and OsCOI1b. because osjaz1-1D can't interact with OsCOI1b, so it can't be JA-dependent proteasome-mediated degradation.


Eg-7.jpg

JA regulates early spikelet development possibly by activating the expression of OsMADS1 through OsMYC2, which is directly regulates OsMADS1 expression.And, OsJAZ1 interacts with OsMYC2 and suppresses the activity of OsMYC2 in triggering the transcription of OsMADS1.Both OsJAZ1 and osjaz1-1D interacted with OsMYC2, and the interaction required the Jas domain.

File:Eg-8.jpg

Inconclude,eg2-1D can't interact with OsCOI1b, so it not degradation, but it also can interact with OsMYC2 to block OsMYC2 regulates the OsMADS1 expression.

Eg-9.jpg

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os04g0653000

Description

The start codon is not identified.

Version

NM_001060638.1 GI:115461005 GeneID:4337240

Length

3445 bp

Definition

Oryza sativa Japonica Group Os04g0653000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:33705210..33708654

Sequence Coding Region

33705211..33705317,33707373..33707475,33707567..33707792,33707906..33707963,33708275..33708365

Expression

GEO Profiles:Os04g0653000

Genome Context

<gbrowseImage1> name=NC_008397:33705210..33708654 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:33705210..33708654 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>ggagaggagaggaaggaggaagaggtggtggtggaggagaagagccatcagcagcagcagcagcaaggggaggaggagctcgtcggcctctcgctcgccggcggcaggcccaaagtatttccaatgtcgagccctccacctaatccttcgcaacttacaattttctatggtggatcagtatgtgtttatgactcagtgccgccagagaaggctcaagcaatcatgcttattgccgcagcagctgctgcagcggcgtctgccaccaaaagcaatgctgccattgctgttaagccccctgtgatgcctgcagccaatgctacccaagcagcagtctctcctgtgctcacaagatcgctctcattgcagagcacttctgtagcaactggacaacctcaagttgccgctgaccctagctcaatttgcaagctccaggctgatctccccattgccaggaggcactcccttcagcgcttcctagagaaacgccgtgacaggttggtgagcaaagctccatatcccacaaaatcctccgagggcatggaagcatcagggatggaagtaactgctgagggcaaggcccagtaa</cdnaseq>

Protein Sequence

<aaseq>GEERKEEEVVVEEKSHQQQQQQGEEELVGLSLAGGRPKVFPMSS PPPNPSQLTIFYGGSVCVYDSVPPEKAQAIMLIAAAAAAAASATKSNAAIAVKPPVMP AANATQAAVSPVLTRSLSLQSTSVATGQPQVAADPSSICKLQADLPIARRHSLQRFLE KRRDRLVSKAPYPTKSSEGMEASGMEVTAEGKAQ</aaseq>

Gene Sequence

<dnaseqindica>2..108#2164..2266#2358..2583#2697..2754#3066..3156#gggagaggagaggaaggaggaagaggtggtggtggaggagaagagccatcagcagcagcagcagcaaggggaggaggagctcgtcggcctctcgctcgccggcggcaggtagttttccggctccgccttctcctctcgcaagtcgagtcctattcagctttgggttgatcgattgggtcgcgggagagagagtatttggttggttgttcgggaaatgcatctcgcgcgggattctagccgcttttcagttcatagtatcgccccttctccgagaactcgccgccggggagccgcttcctgctgggagccgagcggcgccgcagccgcctccgaagtggtttaccggaggggatggattttctccggtactggactcctggtgtttgaatttttgggtggaaccggagactctttttttggtcgggtgaaattccttggaccgaccaaaaaaatctcgaatccactcggagtttcctccgttccagatggagctcttgcgttgaaaattttcctaaaaatagagtcaaaatgtttcgacttcgagttaagagtccaccctacaccgagttgcaactttcccttttttacgagttggtgtaatcatggaagagcccttagctttgctgcagtggatcaaattggtgggggttcttgcctaggtcatgtgaagattcttctgattagtggtagtctcatgcttctcctcggcctgcaatccaaatcccctttattcctttcccgctctcttgcgcttggcgtcagctgttcttaaccttgaacaaattagggtgtcattctagttgcacgtgttcttatccagatgttgggagtgcggtgaactgctgatattctactaaaccgatatcaattatatggatgttcaatttggttcacgtcactaggtaaatgatttcccaccttagaccaaacttaacggataggaaagaacttttggcaagtggcagatccaggtagtttttttccttccctttttctgtaattggcagttacttgttctccaaatacttggaactgctgtgaaaagtttccaattgagccttggaatcaggagcaatggggaactcttctaagttacttgcatttcttctttaaagactcagaaataataagcaagaaacacacatagatctggtgaaacttgagttagcgtgcagtttttaacacctccatgtaccaaggggattcaatggtaaaggcctcatccccttgtcttatctttacttcaagactaaatctgtagctggggaccaagtaccatagtttcgcaactcttatataatccactaggctgctgtgaaaacaatagatgcagtgtttgttttgaagtaagtaaggtgaaagtaaaaatacctggtaatggctaatatgaatcgtggctattattaaatgtttcagcattttctgaataggtaaaccacatatatgtaactatgtaagatgtttttaaatctagatgttctattgagcctgtaacctggtcttttagactagattatgctgagactttgaagaaaaaaatttcagtacattccgtccatcttggacaacctttggacagattattaactctgaatcagtcccatcatgctgcacatgttggatatttcagagtggaccataaagttgcaggcctagtttgctatttttagattttagatcttgtgagttttaatcttgatcatgctattagactcagaatgtgtgtaccaaaaacattgataatggtatctatcctgacttgggtataacttgtgttactggcagctgtgggagggctatgttggcgtagcgtactgaccaagagataatcctctcatcaagtagaatatagagagtagaataattatttatgaaggagatgggcctttatctggctgcagacaaggtgcatagtaaagctcattaaacctctaaaaaaggctggaaatacggcctacggtgtaattgcacattatacatcagttagctaggttggcctccaattttatatggcactttacccttggatgcccatcttatgtattgccatgtactcatgtatgcaattagtcaagaacggcccacttatgccaatatctgtgtaactatgcaatctgttattaccttcttgcacatttactaatttcgctttgtcataatcaggcccaaagtatttccaatgtcgagccctccacctaatccttcgcaacttacaattttctatggtggatcagtatgtgtttatgactcagtgccgccagagaaggtcatattcaccccacttatcttcgttatatcctccgactaactgttgaaagtttatgctaattcgttatctgcaacattgtcatcaacaggctcaagcaatcatgcttattgccgcagcagctgctgcagcggcgtctgccaccaaaagcaatgctgccattgctgttaagccccctgtgatgcctgcagccaatgctacccaagcagcagtctctcctgtgctcacaagatcgctctcattgcagagcacttctgtagcaactggacaacctcaagttgccgctgaccctagctcaatttgcaagctccaggctggtaagactacaagatctttttgtgaatctaaaatggggctgttttaatccctcgtcatatgatgtactaagtgattgaagatgctacaaatttattctttatttgctgtgcagatctccccattgccaggaggcactcccttcagcgcttcctagagaaacgccgtgacaggttggcatgaatgaatgtagaaatagcattctatatttgtctgatgcatttccttaggtttagtggtccattagaacatgctaaaagaatgtggatagctggaaactgacttgtaggggataaaacatttgctttagcttgacttggatacgaaccaagtatatgtgcaaggactgttttcagtttcattaccatagcccatgttttcatgatacataacaaagtagccagtagttatagaaacacagctttctgcaaatttgagaaatccttagcttcaactgattaagccaaatgaccatgttaagcaggttggtgagcaaagctccatatcccacaaaatcctccgagggcatggaagcatcagggatggaagtaactgctgagggcaaggcccagtaactgtcaacttcgaatggtggaggctgacgtttggagggggaaggaaggaaaggcgtcgcgttcattgtttagatggtgtcgcaccctagaaccttactaataatcgaacctatgcccttattatcgttgtactgttccttatgtgctagtctattctgtcatgaatttgtttactcgaacagcaaactgctatgatagtagtatatcattgtacatcatgcatatcattgcctgacaatgttatcgtgttcgtctagtaatgatatcatccaggttaattgttactagt</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0653000, RefSeq:Os04g0653000