Difference between revisions of "Os01g0853400"

From RiceWiki
Jump to: navigation, search
(Expression)
(Expression)
Line 23: Line 23:
 
2.Elongation of OsCOI1-RNAi Plants Is Inhibited by Attenuating GA Signaling.  
 
2.Elongation of OsCOI1-RNAi Plants Is Inhibited by Attenuating GA Signaling.  
 
EUI1 overexpression resulted in a series of GA-deficient phenotypes, with drastic reduction of the bioactive GAs and accumulation or stabilization of the DELLA protein SLR1 .We crossed the EUI1-overexpression plants (Eui1-OX) to the coi1-18 plant (Fig. 3D). The homozygous Eui1-OX/coi1-18 plants showed greatly reduced plant height (Fig. 3 A–C) and reduced cell size in the uppermost internode (Fig. 3 E and F), similar to Eui1-OX plants. In addition, the longer grain phenotype of the coi1-18 plants was also reverted to that of the WT (Fig. 3 G and H). We also crossed coi1-18 with the GA receptor gid1-1 mutant. Again, the gid1-1/coi1-18 double mutant exhibited a dwarf phenotype like gid1-1. This result demonstrated that the GA receptor gene GID1 is required for the function of OsCOI1 in the GA pathway. These results suggest that the OsCOI1-RNAi morphology is dependent on the GA signaling pathway.
 
EUI1 overexpression resulted in a series of GA-deficient phenotypes, with drastic reduction of the bioactive GAs and accumulation or stabilization of the DELLA protein SLR1 .We crossed the EUI1-overexpression plants (Eui1-OX) to the coi1-18 plant (Fig. 3D). The homozygous Eui1-OX/coi1-18 plants showed greatly reduced plant height (Fig. 3 A–C) and reduced cell size in the uppermost internode (Fig. 3 E and F), similar to Eui1-OX plants. In addition, the longer grain phenotype of the coi1-18 plants was also reverted to that of the WT (Fig. 3 G and H). We also crossed coi1-18 with the GA receptor gid1-1 mutant. Again, the gid1-1/coi1-18 double mutant exhibited a dwarf phenotype like gid1-1. This result demonstrated that the GA receptor gene GID1 is required for the function of OsCOI1 in the GA pathway. These results suggest that the OsCOI1-RNAi morphology is dependent on the GA signaling pathway.
 +
[[File:7.jpg]]
 +
 +
 +
Fig. 3. The GA-deficiency mutation reverses the phenotype of coi1-18plants. (A) Morphological phenotype of Eui1-OX/coi1-18. (B) The average plant height of WT, coi1-18, Eui1-OX, and Eui1-OX/coi1-18 plants. (C) The length of each internode of coi1-18 decreased in the Eui1-OX/coi1-18 plants. (D) Expression of OsCOI1 in Eui1-OX/coi1-18. (E and F) Cell lengths at the bases of the uppermost internodes in coi1-18, Eui1-OX/coi1-18, and Eui1-OX plants. (Scale bar, 40 μm.) (G and H) Grain lengths of coi1-18, Eui1-OX/coi1-18, and Eui1-OX plants. Letters on the columns in B, C, F, and H indicate significant differences determined by Tukey–Kramer multiple comparison test (P < 0.05).
  
 
===Evolution===
 
===Evolution===

Revision as of 12:54, 8 June 2014

Please input one-sentence summary here.

Annotated Information

Function

The F-box protein coronatine insensitive 1 (COI1),(The rice genome contains two closely related COI1genes, OsCOI1a(Os01g0853400) and OsCOI1b(Os05g0449500), which share 83% and 82% sequence identity at the DNA and protein levels, respectively.) a component of the SCF E3 ubiquitin ligase, has been identified as a principal component of a receptor of JA in Arabidopsisand other plants, and the JA ZIM domain (JAZ) family proteins are key regulators of JA signaling that repress transcription of JA-responsive genes through interaction with transcription factors, such as MYC2 . This transcriptional repression requires novel interactor of JAZ (NINJA) and TOPLESS corepressor proteins. Bioactive JA, the jasmonoyl-isoleucine conjugate, promotes physical interaction between COI1 and JAZ proteins that results in degradation of JAZs by the 26S proteasome, leading to initiation of JA responses. Therefore, the SCF COI1 –JAZ protein complex acts as a core site of JA perception. As a regulatory loop, JA also activates JAZ gene transcription, leading to thedown-regulation of JA action and the dynamic nature of JA response.

Expression

The transcript levels of both OsCOI1a and OsCOI1bwere significantly reduced in these RNAi lines as detected by RNA blot and quantitative RT-PCR (qRT-PCR) analyses (Fig. 1 A and B), indicating that OsCOI1 expression was effectively knocked down by RNAi.

1.png


(A) Suppression of OsCOI1a expression in transgenic RNAi lines as shown by RNA blot analysis. A fragment of 825 to 1,244 nt ofOsCOI1 was used as the probe, and 25SrRNAwas used as the loading control.


2.jpg


(B) Suppression ofOsCOI1b expression in transgenic RNAi lines as shown by qRTPCR.


2.Elongation of OsCOI1-RNAi Plants Is Inhibited by Attenuating GA Signaling. EUI1 overexpression resulted in a series of GA-deficient phenotypes, with drastic reduction of the bioactive GAs and accumulation or stabilization of the DELLA protein SLR1 .We crossed the EUI1-overexpression plants (Eui1-OX) to the coi1-18 plant (Fig. 3D). The homozygous Eui1-OX/coi1-18 plants showed greatly reduced plant height (Fig. 3 A–C) and reduced cell size in the uppermost internode (Fig. 3 E and F), similar to Eui1-OX plants. In addition, the longer grain phenotype of the coi1-18 plants was also reverted to that of the WT (Fig. 3 G and H). We also crossed coi1-18 with the GA receptor gid1-1 mutant. Again, the gid1-1/coi1-18 double mutant exhibited a dwarf phenotype like gid1-1. This result demonstrated that the GA receptor gene GID1 is required for the function of OsCOI1 in the GA pathway. These results suggest that the OsCOI1-RNAi morphology is dependent on the GA signaling pathway. 7.jpg


Fig. 3. The GA-deficiency mutation reverses the phenotype of coi1-18plants. (A) Morphological phenotype of Eui1-OX/coi1-18. (B) The average plant height of WT, coi1-18, Eui1-OX, and Eui1-OX/coi1-18 plants. (C) The length of each internode of coi1-18 decreased in the Eui1-OX/coi1-18 plants. (D) Expression of OsCOI1 in Eui1-OX/coi1-18. (E and F) Cell lengths at the bases of the uppermost internodes in coi1-18, Eui1-OX/coi1-18, and Eui1-OX plants. (Scale bar, 40 μm.) (G and H) Grain lengths of coi1-18, Eui1-OX/coi1-18, and Eui1-OX plants. Letters on the columns in B, C, F, and H indicate significant differences determined by Tukey–Kramer multiple comparison test (P < 0.05).

Evolution

The rice genome contains two closely related COI1genes, OsCOI1a(Os01g0853400) and OsCOI1b(Os05g0449500), which share 83% and 82% sequence identity at the DNA and protein levels, respectively.

Labs working on this gene

National Key Laboratory of Plant Molecular Genetics, Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai 200032, China;

References

Yang, D.L., et al., Plant hormone jasmonate prioritizes defense over growth by interfering with gibberellin signaling cascade. Proc Natl Acad Sci U S A, 2012. 109(19): p. E1192-200.

Structured Information

Gene Name

Os01g0853400

Description

Similar to Coronatine-insensitive protein 1 (F-box/LRR-repeat protein 2) (AtFBL2) (COI-1) (AtCOI1)

Version

NM_001051366.2 GI:297597978 GeneID:4324818

Length

3825 bp

Definition

Oryza sativa Japonica Group Os01g0853400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:38502654..38506478

Sequence Coding Region

38502654..38502710,38503400..38503953,38505117..38505591,38505672..38506478

Expression

GEO Profiles:Os01g0853400

Genome Context

<gbrowseImage1> name=NC_008394:38502654..38506478 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:38502654..38506478 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcctccgtatgaaacagctagggcagagccagccagcaacaacaagcagcggccgatctccggcgagacggccgctgggagcagccgatccggccccgatccgatgggtggcgaggtgccggagccgcggcggctcaaccgggcgctcagcttcgacgactgggtccccgacgaggcgctgcacctcgtgatgggccacgtcgaggacccgcgggacagggaggcggcgtcgcgggtgtgccgccgctggcaccgcatcgacgcgctcacgcgcaagcacgtcaccgtcgccttctgctacgccgcgcgccccgcgcgcctccgggagcggttcccgcggctcgagtcgctctcgctcaagggcaagccccgcgccgccatgtacgggctcatccccgacgactggggcgcctacgccgcgccatggatcgacgagctcgccgcgccgctcgagtgcctcaaggcgctccacctccgccgcatgaccgtcaccgacgccgacatcgccgcccttgtccgcgcccgcggacacatgctgcaggagctcaagctcgacaagtgcatcggcttctccactgacgccctccgcctcgtcgcccgctcgtgcagatccctgagaactttatttctggaagagtgccatattactgataagggtggtgaatggcttcatgaacttgctgtcaacaattctgttctggtgacactgaacttctacatgactgaactcaaagtggcgccagctgatctagagcttcttgcaaagaattgcaagtcattgatttcattgaagatgagtgagtgtgatctttcagatctgattagtttttttcaaacagccaatgcgctgcaagactttgctggaggagcattctacgaggtaggagagctcaccaagtatgaaaaagttaagttcccacccagattatgcttcttggggcttacctacatgggaacaaatgagatgcctgttatcttccctttttcgatgaaactcaagaaactggacttgcaatacacttttctcacaacagaagatcattgtcagattattgcaaaatgtcccaatctactaattcttgaggtgaggaacgtgataggagatagagggctagaagttgttggtgatacatgcaagaagctacgaagactccgaattgagcggggtgatgatgatccaggtctgcaggaagagcaaggaggagtttctcagctaggcttgacagccgttgctgttggttgccgtgaattggagtacatagctgcctatgtatcggatatcaccaatggggccctggagtctattgggactttctgcaaaaatctatacgactttcggcttgtgctacttgacagagaaagacaggtaacagatctgccacttgacaatggtgtctgtgctctgttaagaaattgcacaaagcttcggaggtttgctctctaccttagaccaggagggctttcagatgatggccttagctacatcggacagtacagtggaaatatccaatacatgctactgggcaatgttggtgaatctgaccatggattgatccgtttcgcagtgggctgcaccaaccttcagaagcttgaattgagaagctgctgcttcagcgagcgagctttgtccctcgctgtactgcagatgccctccctgagatacatatgggtgcaaggatacagagcatctcaaacaggccttgacctcctgctcatggccaggcctttctggaacatcgagtttacacctccgagccctgagagttttaatcatatgacagaagatggagaaccctgtgtggatagccatgctcaggttcttgcctactattcccttgctggaaggaggtctgactgccctcagtgggtgatccccttgcatcctgcgtga</cdnaseq>

Protein Sequence

<aaseq>MPPYETARAEPASNNKQRPISGETAAGSSRSGPDPMGGEVPEPR RLNRALSFDDWVPDEALHLVMGHVEDPRDREAASRVCRRWHRIDALTRKHVTVAFCYA ARPARLRERFPRLESLSLKGKPRAAMYGLIPDDWGAYAAPWIDELAAPLECLKALHLR RMTVTDADIAALVRARGHMLQELKLDKCIGFSTDALRLVARSCRSLRTLFLEECHITD KGGEWLHELAVNNSVLVTLNFYMTELKVAPADLELLAKNCKSLISLKMSECDLSDLIS FFQTANALQDFAGGAFYEVGELTKYEKVKFPPRLCFLGLTYMGTNEMPVIFPFSMKLK KLDLQYTFLTTEDHCQIIAKCPNLLILEVRNVIGDRGLEVVGDTCKKLRRLRIERGDD DPGLQEEQGGVSQLGLTAVAVGCRELEYIAAYVSDITNGALESIGTFCKNLYDFRLVL LDRERQVTDLPLDNGVCALLRNCTKLRRFALYLRPGGLSDDGLSYIGQYSGNIQYMLL GNVGESDHGLIRFAVGCTNLQKLELRSCCFSERALSLAVLQMPSLRYIWVQGYRASQT GLDLLLMARPFWNIEFTPPSPESFNHMTEDGEPCVDSHAQVLAYYSLAGRRSDCPQWV IPLHPA</aaseq>

Gene Sequence

<dnaseqindica>1..57#747..1300#2464..2938#3019..3825#atgcctccgtatgaaacagctagggcagagccagccagcaacaacaagcagcggccggtacgcaataatggaactctccataagccaagcagaggagagagcggtgcggatgcaacagagtactgagagaaaacagagtattttacgcactgttgtcggctagctgtatccgtttgcgtttcagggtaaatccatccatcatcgatccattcatggtggtgggctgctggtggtggtggtggtgctatgctacaggttaatttaggcgatgcttacgtgatgctaacacccagttaacgtggctagggctacgctaagcaaggagcattgaattcgatcgatatgttgggttttttctctttactagtagcatgccatctagtgtgcatcttacgtagtggaatattatcgggcacccaatattcggctcgcacaaagctccgaggacgaggaggaggacgactaatttggcagctcagctcacctgcacggctgcactgtgctgtgcccggtgggcgaagccatttcacccgcgggcttacgtggcccggcaccaccggccgagccgtgcggggaaacaagtaaacgctcgctcgctgcgtctccgatgcccccgtccccgcctggccgctgctgctctctcgctcttctccctccaataattcgcttgccctctggtggctcaaagcccagggaaattgatggagaagaattggggtagccccatgccacctggttcgggctagatctccggcgagacggccgctgggagcagccgatccggccccgatccgatgggtggcgaggtgccggagccgcggcggctcaaccgggcgctcagcttcgacgactgggtccccgacgaggcgctgcacctcgtgatgggccacgtcgaggacccgcgggacagggaggcggcgtcgcgggtgtgccgccgctggcaccgcatcgacgcgctcacgcgcaagcacgtcaccgtcgccttctgctacgccgcgcgccccgcgcgcctccgggagcggttcccgcggctcgagtcgctctcgctcaagggcaagccccgcgccgccatgtacgggctcatccccgacgactggggcgcctacgccgcgccatggatcgacgagctcgccgcgccgctcgagtgcctcaaggcgctccacctccgccgcatgaccgtcaccgacgccgacatcgccgcccttgtccgcgcccgcggacacatgctgcaggagctcaagctcgacaagtgcatcggcttctccactgacgccctccgcctcgtcgcccgctcgtgcaggtaacccaggagttctctctttcttgtactactcatctgtaacagtgattttttttacctccaatacttgcctaagcgaaagttagcagcagcaactgagcagttggtcttttcctcatttagaagttagggttgatctggtggaggtgctaattttgttgttagttggtgttcctaaatggagtaatggatagtagtgacatgttcttagtgttctaacatgggcaagcaaagttgagccaaccttgctcactttctggttcacaaattcctcccccccccccccctcgagaaaggagctgtcacaaattagcttccacagtccactcgtgactggttgaggccataacgcaccgaatttcaacagcaaaatttgtgagcattagatgcgcacaagatttttgcctcaatagatttgtgtggttctttcgtttacctactttcattatttcatctaattgtgtacttgttgagctgggtttgagaagagtccctaatacataaaaacaacttataagaggtagcaagtctggcataagcaatctgctataatttgaggcagacccataacggttggtcatatatcttttaccaggagtaagtactattgtaatggttggattgtacttgaaaaggactaccctgttcctccttagacatatttggaaccaaaatacagttgcaagttggggattatgttgccgccttgccggtcagttatatcatgctccgatttgtgcggcagtatgtcttgtctcatgtttcttgttaactttgcttagtttgactttgagttcgcaacaatgatgtcgcaccaattatccgttaaaaaaaatttataaagaacgcaagaatattttgtgctaaaggtatatatttatttttgagacctaacttgtgaagtctgcatgcatatggagatgtgtggggtggatgaccagtaataccttgtgtggaatgcatgtatgggatgctttgtgatggttggaagtacttcacaagtcactacacatctactatgagttgctatgtttcttgacttaaaatgtgattcctgttctttcctccaatatatatttcttctaacagcaatttcttcatgctcaatgctaagattacatgctatctctgcagtaacatgtcattctaaattatgtcaacagatccctgagaactttatttctggaagagtgccatattactgataagggtggtgaatggcttcatgaacttgctgtcaacaattctgttctggtgacactgaacttctacatgactgaactcaaagtggcgccagctgatctagagcttcttgcaaagaattgcaagtcattgatttcattgaagatgagtgagtgtgatctttcagatctgattagtttttttcaaacagccaatgcgctgcaagactttgctggaggagcattctacgaggtaggagagctcaccaagtatgaaaaagttaagttcccacccagattatgcttcttggggcttacctacatgggaacaaatgagatgcctgttatcttccctttttcgatgaaactcaagaaactggacttgcaatacacttttctcacaacagaagatcattgtcagattattgcaaaatgtcccaatctactaattcttgaggtaatatttcctgtatacaagcattgattaattgtgtttgaattagtatatgccatattacaacgagatgtcctcaacaggtgaggaacgtgataggagatagagggctagaagttgttggtgatacatgcaagaagctacgaagactccgaattgagcggggtgatgatgatccaggtctgcaggaagagcaaggaggagtttctcagctaggcttgacagccgttgctgttggttgccgtgaattggagtacatagctgcctatgtatcggatatcaccaatggggccctggagtctattgggactttctgcaaaaatctatacgactttcggcttgtgctacttgacagagaaagacaggtaacagatctgccacttgacaatggtgtctgtgctctgttaagaaattgcacaaagcttcggaggtttgctctctaccttagaccaggagggctttcagatgatggccttagctacatcggacagtacagtggaaatatccaatacatgctactgggcaatgttggtgaatctgaccatggattgatccgtttcgcagtgggctgcaccaaccttcagaagcttgaattgagaagctgctgcttcagcgagcgagctttgtccctcgctgtactgcagatgccctccctgagatacatatgggtgcaaggatacagagcatctcaaacaggccttgacctcctgctcatggccaggcctttctggaacatcgagtttacacctccgagccctgagagttttaatcatatgacagaagatggagaaccctgtgtggatagccatgctcaggttcttgcctactattcccttgctggaaggaggtctgactgccctcagtgggtgatccccttgcatcctgcgtga</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0853400, RefSeq:Os01g0853400