Difference between revisions of "Os07g0498800"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
−
Please input one-sentence summary here.
+
'''''CRTintP1''''' '''confers cold tolerance''' on rice plants<ref name="ref1"/>.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
−
Please input function information here.
+
CDPK13, calreticulin and CRTintP1 '''might''' be '''important signaling components''' for '''response to cold stress''' in rice<ref name="ref1"/>. CRTintP1 was identiWed as a calreticulin-interacting protein by yeast two-hybrid system and was '''binding to calreticulin''' using immuno-precipitation system, which indicating that '''CDPK13, calreticulin and CRTintP1 were related with each others'''<ref name="ref2"/>.
 +
 
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0006464 GO:0006464]
 +
 
 +
===Mutation===
 +
Transgenic rice<ref name="ref1"/>:
 +
*'''Accumulation of calreticulin protein''' and '''CRTintP1 protein''' in the sense calreticulin and CRTintP1 transgenic rice was '''higher''' than those in vector control transgenic rice, respectively.
 +
*Calreticulin protein in sense CRTintP1 transgenic rice and CRTintP1 in sense calreticulin transgenic rice were also higher than that in the vector-control transgenic rice. These data demonstrate the interaction of calreticulin with CRTintP1 in vivo, which is in agreement with the observations obtained from the yeast two-hybrid analysis.
  
 
===Expression===
 
===Expression===
−
Please input expression information here.
+
*Northern and immunoblot analysis showed increased expression of calreticulin and CRTintP1 in '''response to cold stress'''. Co-immunoprecipitation using anti-calreticulin antibodies confirmed the existence of the calreticulin- CRTintP1 complex in vivo in the stressed '''leaf tissue'''<ref name="ref3"/>.
 +
 
 +
*CRTintP1 was identified as a calreticulin-interacting protein by yeast two-hybrid systems and was found bound to calreticulin using immono-precipitation system. The interaction of calreticulin with CRTintP1 in vivo, which is in agreement with the observations obtained from the yeast two-hybrid analysis<ref name="ref2"/><ref name="ref3"/>.
 +
 
 +
===Subcellular localization===
 +
Cellular localization studies showed that a fusion of CRTintP1 to green fluorescent protein was directed to the '''nucleus in onion epidermal cells'''<ref name="ref2"/>.
  
−
===Evolution===
+
===Knowledge Extension===
−
Please input evolution information here.
+
*Calreticulin (CRT), a major Ca<sup>2+</sup>-sequestering protein, has been implicated in a variety of cellular functions such as Ca<sup>2+</sup> storage, signaling and chaperone activity within the cytoplasm and endoplasmic reticulum. To investigate the biological role of CRT in rice, 21 partial cDNAs, encoding proteins that interacted with rice CRT in a yeast two-hybrid interaction-cloning system, were characterized and the nucleotide sequences were found to be identical to each other<ref name="ref2"/>.
  
−
You can also add sub-section(s) at will.
+
*Northern and immunoblot analysis showed increased expression of CRT and CRTintP in response to cold stress. Co-immunoprecipitation using anti-CRT antibodies confirmed the existence of the CRT-CRTintP complex in vivo in the stressed leaf tissue, suggesting their potential role in regulating stress response<ref name="ref2"/>.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
−
Please input related labs here.
+
*National Institute of Crop Science, 2-1-18 Kannondai, Tsukuba 305-8518, Japan
 +
*National Institute of Agrobiological Sciences, Tsukuba 305-8602, Japan
 +
*National Agricultural Research Center for Tohoku Region, Akita 014-0102, Japan
  
 
==References==
 
==References==
−
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Komatsu S, Yang G, Khan M, et al. Over-expression of calcium-dependent protein kinase 13 and calreticulin interacting protein 1 confers cold tolerance on rice plants[J]. Molecular Genetics and Genomics, 2007, 277(6): 713-723.
 +
</ref>
 +
* <ref name="ref2">
 +
Sharma A, Isogai M, Yamamoto T, et al. A novel interaction between calreticulin and ubiquitin-like nuclear protein in rice[J]. Plant and cell physiology, 2004, 45(6): 684-692.
 +
</ref>
 +
* <ref name="ref3">
 +
Komatsu S. Rice proteome database: a step toward functional analysis of the rice genome[J]. Plant molecular biology, 2005, 59(1): 179-190.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 12:37, 23 March 2015

CRTintP1 confers cold tolerance on rice plants[1].

Annotated Information

Function

CDPK13, calreticulin and CRTintP1 might be important signaling components for response to cold stress in rice[1]. CRTintP1 was identiWed as a calreticulin-interacting protein by yeast two-hybrid system and was binding to calreticulin using immuno-precipitation system, which indicating that CDPK13, calreticulin and CRTintP1 were related with each others[2].


GO assignment(s): GO:0006464

Mutation

Transgenic rice[1]:

  • Accumulation of calreticulin protein and CRTintP1 protein in the sense calreticulin and CRTintP1 transgenic rice was higher than those in vector control transgenic rice, respectively.
  • Calreticulin protein in sense CRTintP1 transgenic rice and CRTintP1 in sense calreticulin transgenic rice were also higher than that in the vector-control transgenic rice. These data demonstrate the interaction of calreticulin with CRTintP1 in vivo, which is in agreement with the observations obtained from the yeast two-hybrid analysis.

Expression

  • Northern and immunoblot analysis showed increased expression of calreticulin and CRTintP1 in response to cold stress. Co-immunoprecipitation using anti-calreticulin antibodies confirmed the existence of the calreticulin- CRTintP1 complex in vivo in the stressed leaf tissue[3].
  • CRTintP1 was identified as a calreticulin-interacting protein by yeast two-hybrid systems and was found bound to calreticulin using immono-precipitation system. The interaction of calreticulin with CRTintP1 in vivo, which is in agreement with the observations obtained from the yeast two-hybrid analysis[2][3].

Subcellular localization

Cellular localization studies showed that a fusion of CRTintP1 to green fluorescent protein was directed to the nucleus in onion epidermal cells[2].

Knowledge Extension

  • Calreticulin (CRT), a major Ca2+-sequestering protein, has been implicated in a variety of cellular functions such as Ca2+ storage, signaling and chaperone activity within the cytoplasm and endoplasmic reticulum. To investigate the biological role of CRT in rice, 21 partial cDNAs, encoding proteins that interacted with rice CRT in a yeast two-hybrid interaction-cloning system, were characterized and the nucleotide sequences were found to be identical to each other[2].
  • Northern and immunoblot analysis showed increased expression of CRT and CRTintP in response to cold stress. Co-immunoprecipitation using anti-CRT antibodies confirmed the existence of the CRT-CRTintP complex in vivo in the stressed leaf tissue, suggesting their potential role in regulating stress response[2].

Labs working on this gene

  • National Institute of Crop Science, 2-1-18 Kannondai, Tsukuba 305-8518, Japan
  • National Institute of Agrobiological Sciences, Tsukuba 305-8602, Japan
  • National Agricultural Research Center for Tohoku Region, Akita 014-0102, Japan

References

  1. ↑ 1.0 1.1 1.2 Komatsu S, Yang G, Khan M, et al. Over-expression of calcium-dependent protein kinase 13 and calreticulin interacting protein 1 confers cold tolerance on rice plants[J]. Molecular Genetics and Genomics, 2007, 277(6): 713-723.
  2. ↑ 2.0 2.1 2.2 2.3 2.4 Sharma A, Isogai M, Yamamoto T, et al. A novel interaction between calreticulin and ubiquitin-like nuclear protein in rice[J]. Plant and cell physiology, 2004, 45(6): 684-692.
  3. ↑ 3.0 3.1 Komatsu S. Rice proteome database: a step toward functional analysis of the rice genome[J]. Plant molecular biology, 2005, 59(1): 179-190.

Structured Information

Gene Name

Os07g0498800

Description

Calreticulin interacted protein

Version

NM_001066246.1 GI:115472224 GeneID:4343305

Length

8474 bp

Definition

Oryza sativa Japonica Group Os07g0498800, complete gene.

Source

Oryza sativa Japonica Group 

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:19377339..19385812

Sequence Coding Region

19377627..19377701,19378023..19378178,19378430..19379032,19379303..19379631,19379729..19380292
,19380865..19380979,19381063..19381134,19381217..19381381,19382341..19382489
,19382567..19382636,19382712..19382858,19382936..19383004,19383274..19383314
,19383859..19383957,19384519..19384636,19384814..19384942

Expression

GEO Profiles:Os07g0498800

Genome Context

<gbrowseImage1> name=NC_008400:19377339..19385812 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:19377339..19385812 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtctgaagatgcgtctgtcggggccagcagttcaacagtaaaagctggcgatgatccagaggctaccattgagatcaacatcaaaaccctggattcacaagttcataagctccgtgttaagaagaatgtacctgttctggtccttaaagagaagatagtagaggcaaccggggttcctgtggaccaacagcggttgatttttagaggaagagtcttaaaggacgatcacctgctatcagaatatcatttggaagatgggtacacattgcatttggttgctcggcgtgcagctgctgaaggccaacattcttctggtacttctgatgaaaacacccatgctaatgttaatgttgctggaaatggactgttaggagatatctccaggagtgttcgggatatccttggctccctaggtcttgcgacgcctggtggcatgacaaacactacattttcggtgcctttaaccactgcaccagaaggggccaataatgtcaatggaagaactcaaccagggaatcatgcacaaccagggttttcaattctgaatcatcaaatccaagtatcacaactacaaccagcaggctctattcctcgcaacatggttattcctgattctctcacaactcttttggagtatatcaaccgcatggatcaagtactacagaataacggcacaccatctgttgatacaaatacccagcagccaccaagatcggatgatgcttatctaaatcaaagatttccaagtcctgaggttctggtgtcagtcattgaaagagcccaacaacttcttggtggcagtgctgcttctgctctttcacatctcgcacaacgaatccagagagattctggcaccagtgatgcatctatacgtagccagatccagaatgaatcagctcagctgggagtagcaatgcagcatttgggtgcaatgtttttggagcttggtcgaacaatgatgatgcttcggatggggccatcccctgctgatgcttttgtcaatgctggatcttctgtttatataaactctgcaggaccgaatccaatcatggttcagccatcttttcaaaatactcctccttttggagtttcgagcataccagtcctcggtggaatttctggtgcctttggtattgttgatccttctcgtacatctgctgtcaatacccatggtacttctacaacaagtgggtcatctgctggtatgaccactgcttctgcaggcgctgtcaatgaaggtcgtcaaaatgtggaaagaactcaaggaggtaacccatctgctacctcaatgcatggattgccagcaaggacagttattgcggctattcctgcacggtccacggctgaggctccaaaccatgtcctgagtgttatcctgcctgttcaagtgaggagtcaagtagcaatgcctaatcaatcaacagtttctcaaggttctcagactgcagtgggcggtggatctcaaccacaagcctctgtaggtggtgttgctagcattccttctatagtggcacaggtaactgcacaagtagccaatgcattgagtgcaaatcaacaaggccaggtttcatcatctgcgcagaacacagtagatcagggatctcgctcggtcacaactaatggagttgacaatgtggattctctggtatcagcaagtacgcaactgcaaaatgagctgtcagattctaacaatggacgcacttcactaaatgcacaatctcttgtagctggagcaggtatttctccttcaaacacatctgatcccaatttagcatcggaagacagcagcactgaaaatgctcccaacatcggcagtattcaacaacatccagagatggaagggatccatgcagataatgtcagaaaaccttctgaggaatcaacaacagccaacttagtggggcagatcacaaccacctgtacagatgatatttctgtgaacagatcagcagaaaattcttcacagaagaacattccattggatggagtatctgcacagtccattaagccatctgcaagtagtaggtctgaaccagtaggtcttggtggaggtttgcagcctaagaggcggagcagaacagcaaagccacctgggagtagcagtgatactggcgaagtcgtcaattcctctcgcatcagcaatagccaaaatgctgtttcaatgggccagcaggttctgcaagcccttgcttctcaaaatactaatgtaaacagaagccatgttacggattctccacttccatccactacttctcagttttctggtggaatgcctccgagaagacagggtggtgaaggacaagttgattttggcagtatgatatccagtgtgctaaacaacccagcttttggcaatctgttgtccaatgtagcagagcaaacaggcatgggttccgcaggtgatttgagaaacatggtggaagagtgtgcacagagccctgcaataatggatactatgagtaatttagtccaaaatgtggatgggtcaggaagaggtcaaggtggcattgacttgtctagaatgatgcagcaaatgatgcctgttgtatcccaagttcttggtggagctggggctcgtcctgctggtacaaatagtggacaatccagattgcagcctcggcgcagtgacatgagagtggatgatgcttcagattatggaaattctcagattgatctacaccaagctcgtgaacacattgagcaacatgactcccccagggatatcttcggtgcggtcctcgaaactgctgcacaggcttatggtgaagatgagagtattgaggacatgcttgaagagcttgtcagtgacccagaacttacagatgactacctgaaacttctgctccaacaagttcgccagaggatacagtcggcatctcaatccgggaaccagtcttga</cdnaseq>

Protein Sequence

<aaseq>MSEDASVGASSSTVKAGDDPEATIEINIKTLDSQVHKLRVKKNV PVLVLKEKIVEATGVPVDQQRLIFRGRVLKDDHLLSEYHLEDGYTLHLVARRAAAEGQ HSSGTSDENTHANVNVAGNGLLGDISRSVRDILGSLGLATPGGMTNTTFSVPLTTAPE GANNVNGRTQPGNHAQPGFSILNHQIQVSQLQPAGSIPRNMVIPDSLTTLLEYINRMD QVLQNNGTPSVDTNTQQPPRSDDAYLNQRFPSPEVLVSVIERAQQLLGGSAASALSHL AQRIQRDSGTSDASIRSQIQNESAQLGVAMQHLGAMFLELGRTMMMLRMGPSPADAFV NAGSSVYINSAGPNPIMVQPSFQNTPPFGVSSIPVLGGISGAFGIVDPSRTSAVNTHG TSTTSGSSAGMTTASAGAVNEGRQNVERTQGGNPSATSMHGLPARTVIAAIPARSTAE APNHVLSVILPVQVRSQVAMPNQSTVSQGSQTAVGGGSQPQASVGGVASIPSIVAQVT AQVANALSANQQGQVSSSAQNTVDQGSRSVTTNGVDNVDSLVSASTQLQNELSDSNNG RTSLNAQSLVAGAGISPSNTSDPNLASEDSSTENAPNIGSIQQHPEMEGIHADNVRKP SEESTTANLVGQITTTCTDDISVNRSAENSSQKNIPLDGVSAQSIKPSASSRSEPVGL GGGLQPKRRSRTAKPPGSSSDTGEVVNSSRISNSQNAVSMGQQVLQALASQNTNVNRS HVTDSPLPSTTSQFSGGMPPRRQGGEGQVDFGSMISSVLNNPAFGNLLSNVAEQTGMG SAGDLRNMVEECAQSPAIMDTMSNLVQNVDGSGRGQGGIDLSRMMQQMMPVVSQVLGG AGARPAGTNSGQSRLQPRRSDMRVDDASDYGNSQIDLHQAREHIEQHDSPRDIFGAVL ETAAQAYGEDESIEDMLEELVSDPELTDDYLKLLLQQVRQRIQSASQSGNQS</aaseq>

Gene Sequence

<dnaseqindica>8112..8186#7635..7790#6781..7383#6182..6510#5521..6084#4834..4948#4679..4750#4432..4596#3324..3472#3177..3246#2955..3101#2809..2877#2499..2539#1856..1954#1177..1294#871..999#agttctcacttctcacacaactcgcaaccctaataaagcgcaaaaaaggaaaaagaaaaatcgccacggaaaaatcctcgctgccccccatcgggcaggagcaaccgccgcatcggcccccgatccggtcgccgccgcctctcgcccggttcatccgccgcttgccaacccctccgctcccagcaaccctagtcccccaccccaacgccgccgccagctcagctcgcctcgcgcggggcgcagccgactctctacttgtggcctcggcggctcgggccctctccggattccacgtatggctcgatcttctgcttttctttttcttctttttttttttttaattattcgggaattgaagcctcatcctattgggggcatacgcgacttggcggagaggacaatggcgacgcatttcagagctaaggggggaagggatatgattttgaggctgtaattgcttgcgaagttctccttttggaagggatcggtcctagccattctgagctgctaaaaattttatttgcggtacggagcgtcttctgataagaggacagaacgattagggtctcccgtaatctgcttttaaatgcttgatggagtcctagaacctaaaattatggaattttctctaatgttaagctaggaatgagggtactggtttcttcgtagatggaaggcgctctacttgttgctgccggaactctgttgagatcttgtgcttaaatgcaggggtttaactggctgtgtaatcttaggcgtggagtgagttgactatgaagaattctgaacatgtctaggaatcataatttcgaattttgtagcttgtggtttatgcagcatctgatactattcagttcctcgttctgtaggatgtctgaagatgcgtctgtcggggccagcagttcaacagtaaaagctggcgatgatccagaggctaccattgagatcaacatcaaaaccctggattcacaagttcataagctccgtgttaagaagaatgtatgcttcgccccaccttgacagtttgctattatgtctctgtgtgtctgttgagtgttgcttgcttgaagagatactagaaatgctatagaatgtcagttccttatagttagaacgacaagatgaattctcccatgtacttgttttgagacaatctaatcactgaaaaatttttaggtacctgttctggtccttaaagagaagatagtagaggcaaccggggttcctgtggaccaacagcggttgatttttagaggaagagtcttaaaggacgatcacctgctatcagaatatcgtatcctttttgttcatgcttcttcttttgaatgcttgaagacaatcaaaccatctagagactcacctcgcttgttgctgttgagaacttgagctatatacactatttacctgcattttgtttcccatctttagttgcttagttataaataggccgggaagatacacaactcttttgggccagtaagggtgatttcgttactgctagaagagtagagtgcctgatgcttttgttgggattagggctgcttgctttggtagtgatttcataatggccttccaatgagacaaaataaagtagtaaaatgtcaaattgaagtatctaagcattaattctttgcaaatatgggcaagaacctcaaatcattgtagaccttgatgatatttgttaagttgaggtggttgaacaccagtatttaactgcatcgttggtggtaatgaggggttccttggatcaacgattttcatcaccacatgatgtaatttatcattttcggttttcttgtgatatttcgtttgtaaacacgacagttgtgatagttatatctttgacaacctcaagatttggaagatgggtacacattgcatttggttgctcggcgtgcagctgctgaaggccaacattcttctggtacttctgatgaaaacacccatgctaatggtaagttaagttgggggttgctttgaagagtatactatcaatatagaacgcacctgatatgcctatgacctattagtcctcagagccatgtgctgcacaagttttcgtagtatcgtaaacaatttatgtgcgttttcactcttcaataccatgtttccatgtgtctgttctatatattaattgtgtcaagctcatactggataaaatattattgccctttgaagggcagaaaaatagttattgctagttattgtaaaaaatagctaggtaagcatttcaggctaagtagatgaaggcttgaacagtccttcgctttatttttcatttaatttgtgaactaaaaacaccattatttaactgtatttatgtaagcattactgtgtttctagttattacaatatatagatagagcataacaaatcaacttgggttatattgactggcactaccttttgtggtaccagagtgtatttcctctgtacctgattttaggtatattacagcaatatgctgggtatgggtctgataatctttttacgtgcagttaatgttgctggaaatggactgttaggagatatctccagggtatgcttctaacatcgctttgtctcgtatacttaaaatttccaatctgcttaactcttagcaacaactacaggttaactttaattttctttgaattctttttcattaactctcttctaggaaattatagaggctatgcattctgaggggatgatagatgacctggctagggtatatgctttgttctagtgttatatgtacctgtctaaatggggaccagaacctttatatgtttattgatgtgatttcctcccacctgttatctgcagagtgttcgggatatccttggctccctaggtcttgcgacgcctggtggcatgacaaacactacattttcggtaataaggtgttacttctttaggtctagtaacctgagacatctcggtatttgacttctatatgtttacttgattaggtgcctttaaccactgcaccagaaggggccaataatgtcaatggaagaactcaaccagggaatcatgcacaaccagggttttcaattctgaatcatcaaatccaagtatcacaactacaaccagcaggctctattcctcgcaacatggttagtaaactgtacttttttcattggtgttttcccatgtataatcatcattataacttttagcaccattgacaggttattcctgattctctcacaactcttttggagtatatcaaccgcatggatcaagtactacagaataacggtatcgtttgttgcaatttgttagtttgatgtgtgtcataaaatactgtcatgttcatctttatgttgcaaattcaggcacaccatctgttgatacaaatacccagcagccaccaagatcggatgatgcttatctaaatcaaagatttccaagtcctgaggttctggtgtcagtcattgaaagagcccaacaacttcttggtggcagtgctgcttctgctctttcagtatgttatcctctctggtacttatattaagttctttttagcttcagtggttcagcctttatagtgatatcttgtcgacgtatagtttatccttctttgtaagtactatattttgtaatgattttgccttctttctaatcagcaaaataattctctttgaacatcaatatgttgccaatgtactacttttcagttctcttatttgagacaaaactatggagatttaaaccaaaataaatccattgtcccattccgtgaccataatcctgctcacagttatctctaatggaccatatacatttaatggctgatactacttgttacaatatagatgattaggctttataacaactactaggaggaacttttagccacttcgtggtacaaaaataacactctagtgttgtgttttgaatataatttttgttttgccttgggtactaggtctgccttagtgccgtgtaacactgctctatattatccctgaatattatatgaggattcaaatggtatttgtaaacgttttgtaccaccactctgcattatccctgaatattatatgagaattcaaatggtatttataaacaccagatgttatttgtttgagagactgatgatctgtttttcattcttttctgcactatccctgctaacattttcctttgggtgccgtacacttgatctgtttttcattcttctctagcattgattgacatgtgaaaggtctaagtggacctctcaaaggtatcaatgggacattagtcttcctagttcggttcttttctctttttttattatgatacccacatttcatacttctcaacgcttattgattcaaaggggtcatatgtacgcagcttcaagactgagtacagtgaaatagcttacctttgaattcacagacgcatgcttctatttggaattttgatgaccttctgtttacctgatatttgtttcagcatctcgcacaacgaatccagagagattctggcaccagtgatgcatctatacgtagccagatccagaatgaatcagctcagctgggagtagcaatgcagcatttgggtgcaatgtttttggagcttggtcgaacaatgatgatgcttcggatggggccatcccctgtatgcttaatttaaattctctattatagtatttaactgatttctgcatgtgttaatttcataacgcttcttattttggtaggctgatgcttttgtcaatgctggatcttctgtttatataaactctgcaggaccgaatccaatcatggttcaggtgacatacattgagatgctttctcatgttgactttaattgttgtgccactttaatgacaacacacattctattgctctgcagccatcttttcaaaatactcctccttttggagtttcgagcataccagtcctcggtggaatttctggtgcctttggtattgttgatccttctcgtacatctgctgtcaatacccatggtaagatcacatttcaagttctcttcagtggctctgttgagtgtactcagctgagtcatgaagctaccatttcaaatccttaatctctactgagaagttcaaatggttatggttatggcctatgattacaaactattacactaataggttagtaggtaaattatctgttagttatttcccttttttttttcttgaacacgagggagttcttccctatattacctgcttcgtcctgatttacctctaaccagaactgaaagatcataacagttttcatatatttatgggatttttcacagggtttatttacacctggatacaatattggtggcctttaattacgattcttttttcaccatctttgtgttagttttcccacatattaccccctcctcctgatttacccctaaccagaccggaagatcataatagctgtaatatatttatgggattttccacagggtttatttacacctggatactgtcatcttggtggcctttgattacaattcttttgtcacactcttgtctgtcctgagcttccactcagacttgatatgatcctttactaggtacttctacaacaagtgggtcatctgctggtatgaccactgcttctgcaggcgctgtcaatgaaggtcgtcaaaatgtggaaagaactcaaggaggtaacccatctgctacctcaatgcatggattgccagcaaggacagttattgcggctattcctgcacggtccacggctgaggctccaaaccatgtcctgagtgttatcctgcctgttcaagtgaggagtcaagtagcaatgcctaatcaatcaacagtttctcaaggttctcagactgcagtgggcggtggatctcaaccacaagcctctgtaggtggtgttgctagcattccttctatagtggcacaggtaactgcacaagtagccaatgcattgagtgcaaatcaacaaggccaggtttcatcatctgcgcagaacacagtagatcagggatctcgctcggtcacaactaatggagttgacaatgtggattctctggtatcagcaagtacgcaactgcaaaatgagctgtcagattctaacaatggacgcacttcactaaatgcacaatctcttgtagctggagcaggtgcctttacattctttttaatgtatcgaacattttctctaatggaaaatgtactgaattgttcaccattcctgtttgttttaatttctctaatcaggtatttctccttcaaacacatctgatcccaatttagcatcggaagacagcagcactgaaaatgctcccaacatcggcagtattcaacaacatccagagatggaagggatccatgcagataatgtcagaaaaccttctgaggaatcaacaacagccaacttagtggggcagatcacaaccacctgtacagatgatatttctgtgaacagatcagcagaaaattcttcacagaagaacattccattggatggagtatctgcacagtccattaagccatctgcaagtagtaggtctgaaccagtaggtcttggtggaggtttgcagcctaaggtattagttaattattttagtgtttactttttagtaataatgtttcctgtaatttgattgtttagcctgcattttgttatccatatcttagcggggttagaatttgccatggttggcagcagtttagttgattggtttaatcacttcaccatttggtctgaatgaaaatggcagacattttactgttgagaaaacgtagtatgccattcatacatgattatttgtcccaaatatgatatgatccccccttctgaaactgctttgatgcagaggcggagcagaacagcaaagccacctgggagtagcagtgatactggcgaagtcgtcaattcctctcgcatcagcaatagccaaaatgctgtttcaatgggccagcaggttctgcaagcccttgcttctcaaaatactaatgtaaacagaagccatgttacggattctccacttccatccactacttctcagttttctggtggaatgcctccgagaagacagggtggtgaaggacaagttgattttggcagtatgatatccagtgtgctaaacaacccagcttttggcaatctgttgtccaatgtagcagagcaaacaggcatgggttccgcaggtgatttgagaaacatggtggaagagtgtgcacagagccctgcaataatggatactatgagtaatttagtccaaaatgtggatgggtcaggaagaggtcaaggtggcattgacttgtctagaatgatgcagcaaatgatgcctgttgtatcccaagttcttggtggagctggggctcgtcctgctggtacaaatagtggacaatccagattgcagcctcggcgcagtgacatgagagtggatgatgcttcagattatggaaattctcaggtaagtcatccagctgaataggttggaactgcctgtatttgcatttgttcttcttagtattatggcttgtgcttatatggtttatttgtgaagaaaaaaattgtgatgattactaatacaccatatctggacaaatgttcattctaaagggttgagaatgtcatatgcaagactgacaaatggaaaacaatatcttttttttttaactttttgataattcataaactaccatcctgctttttcatgcacagattgatctacaccaagctcgtgaacacattgagcaacatgactcccccagggatatcttcggtgcggtcctcgaaactgctgcacaggcttatggtgaagatgagagtattgaggacatgcttgaagagcttgtcagtgacccagaacttacagatgtatgtttccaaaatccccccatccaaatttagaataagctctaatgattttcataggatgccatatagttgataccgtagggtgagattgtttagaaacatacattaggagattatgttatactaatatgtatacatatataaaaaggcaagagatcattttgtggtaaaataagtggtatatgcttcttatatgatcttttgtcaaaataaataaaaaatctgataggattttgcagtaccttgtttgcctttttttttctttttagaaaactttgtttgccttctgattaaccctaaactgctgcaaatatatgctaggactacctgaaacttctgctccaacaagttcgccagaggatacagtcggcatctcaatccgggaaccagtcttgagcaatcatggcaaagaaggtgatccagatatagaggtgattgcataggcaaggtggttgaaccatgcaggtattcactgcagagtttatattttataagttgaaaatggacagaacccagtgtttggtttggtggtcatgattaggcgcctccgtggatgtacatgtgccgtgttctctaattttggcctcagagatgatgtttacaccacccactgcacttgctttaaatgttttacagattttgttagtggtacatagctatcatcaagagctttagatttcgtgg</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0498800, RefSeq:Os07g0498800

Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os07g0498800&oldid=184934"