Os05g0597100

From RiceWiki
Revision as of 06:47, 16 May 2014 by Liangsara (talk | contribs) (Expression)
Jump to: navigation, search

OsHDT1(Os05g0597100),is a histone deacetylase gene, that is involed in flowering time control and innate immunity in rice.

Annotated Information

Function

OsHDT1 function in histone deacetylation[1]: OsHDT1 may be involved in histone deacetylation on a subset of genes, as over-expression of OsHDT1 led to decreases of histone acetylation on flowering repressor genes in both parent and hybrid backgrounds. Increased OsHDT1 promoted deacetylation that correlated with the repression of OsGI and Hd1 and early flowering in the hybrid. The effect of OsHDT1 seemed to occur at a higher acetylation phase of target genes, suggesting that OsHDT1 might be involved in circadian oscillation of histone acetylation and gene expression.

OsHDT1 function as a trans-acting regulator of hybrid differential gene expression[1]: The nonadditive up-regulation (or overdominance) of OsGI and Hd1 observed in the hybrid likely contributed to the below mid-parent expression of Ehd1, RFT1 and Hd3a under long day conditions. Reduction of the nonadditive increase of Hd1 and OsGI by OsHDT1 over-expression and the early flowering phenotype indicates that the “late flowering overdominance” in SY63 can be suppressed by elevated OsHDT1. These observations together with the effects of altered OsHDT1 expression on other nonadditive genes provide direct evidence of regulation of nonadditive or differential gene expression in hybrid by a trans-acting factor.

OsHDT1 level was important for a subset of differentially expressed genes including flowering time genes in the hybrid, suggesting that OsHDT1 may have a function in parental genome interaction for gene expression in the hybrid[1].

The histone deacetylase gene OsHDT1 is associated with enhanced utilization of heterosis in rice [2].

Expression

Rice OsHDT belongs to the plant specific class of HDAC, the expression of which displays a circadian rhythm.

OsHDT1 expression displays a circadian rhythm: OsHDT1 expression exhibited also a circadian oscillation and was sensitive to photoperiods[1].

OsHDT1 over-expression affects the flowering time of hybrid rice[1]; increased OsHDT1 level may alter flowering time-related gene expression in the hybrid, while without a clear effect in the parent background.

OsHDT1 over-expression suppresses overdominance expression of flowering time genes in hybrid rice[1]; increased OsHDT1 expression suppressed the overdominance expression of OsGI and Hd1 in the hybrid under long day conditions, which led to early flowering.

Impact of altered OsHDT1 levels on gene expression in rice hybrid[1]; OsHDT1 over-expression had a negative impact on histone H4 acetylation on these genes in both parent and hybrid backgrounds.

Over-expression of OsHDAC1 (HDA702) led to increased growth rate and altered architecture in transgenic rice[3].

OsHDAC1 could epigenetically repress the OsNAC6 gene that controls rice seedling root growth[4].

OsHDAC1 binds to the OsNAC6 promoter and deacetylates histones H3 and H4. Down-regulation of a Sir2-type HDAC gene, SRT701 (OsSRT1), induced H2O2 production, DNA fragmentation, cell death and lesions mimicking plant hypersensitive responses induced by pathogen attacks, whereas over-expression of the gene enhanced the tolerance to oxidative stress[5].

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

[1] Li C, Huang L, Xu C, Zhao Y, Zhou DX (2011) Altered levels of histone deacetylase OsHDT1 affect differential gene expression patterns in hybrid rice. PLoS ONE 6:e21789. [2] Zhou Daoxiu, Li Chen, Huang Limin, Use of a Histone Deacetylase Gene OsHDT1 in Enhancing Rice Heterosis. GEN, 2010. [3] Jang et al., 2003 I.C. Jang, Y.M. Pahk, S.I. Song, H.J. Kwon, B.H. Nahm, J.K. Kim Structure and expression of the rice class-I type histone deacetylase genes OsHDAC1-3: OsHDAC1 overexpression in transgenic plants leads to increased growth rate and altered architecture.Plant J., 33 (2003), pp. 531–541. [4]Chung et al., 2009 P.J. Chung, Y.S. Kim, J.S. Jeong, S.H. Park, B.H. Nahm, J.K. Kim The histone deacetylase OsHDAC1 epigenetically regulates the OsNAC6 gene that controls seedling root growth in rice Plant J., 59 (2009), pp. 764–776. [5]Huang et al., 2007 L. Huang, Q. Sun, F. Qin, C. Li, Y. Zhao, D.X. Zhou Down-regulation of a SILENT INFORMATION REGULATOR2-related histone deacetylase gene,OsSRT1, induces DNA fragmentation and cell death in rice.Plant Physiol., 144 (2007), pp. 1508–1519.

Structured Information

Gene Name

Os05g0597100

Description

Similar to Nucleolar histone deacetylase HD2-p39

Version

NM_001063058.1 GI:115465846 GeneID:4339823

Length

2800 bp

Definition

Oryza sativa Japonica Group Os05g0597100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:29835095..29837894

Sequence Coding Region

29835401..29835461,29835543..29835675,29835762..29835858,29835978..29836046,29836126..29836283
,29836388..29836432,29836503..29836530,29836661..29836879,29836980..29837050
,29837799..29837811

Expression

GEO Profiles:Os05g0597100

Genome Context

<gbrowseImage1> name=NC_008398:29835095..29837894 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:29835095..29837894 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagttctggggtcttgaagtcaagcctggacagactgtcaaatgtgagcctgaagatgaacgctttttgcacctttctcaggctgctcttggggaatcaaagaaaggatctgacaatgcagtaatgtatgttaaaactgatgatcaaaagctagtcattggaaccctctcagctgacaagttccctcaaatccagtttgatttggtctttgacaaagagtttgagctgtcacacacttcaaagactgctagtgtgttcttttctggctacaaagtttcccagccggctgaggaagatgaaatggattttgattctgaagaagttgaagatgaagaggaggaagaaaagatcattccagctcccagggcaaatggcaaagttgaagggaaggaaaatgagcagaaaaaacaaggcaagacagattcttcagcttcaaaatcaaaggctgcagtgaatgacgatgatgatgatgatgacagtgatgaggatgattctgaggacgaagatctttctcctgaggatgatgatgatgattcttctgaggatgattccagcgaagatgatgaggatgagagtgacgaggaagatactcccaagaagccagagactggaaagaggaaagtagctgaaattgtgttgaagacaccttcgtctgataagaaagcaaagattgctacaccgtcaggccagaagacaggtgacaagaagggtgtccatgtagcaactccacatccggcaaagcaggctagcaagacccccgtgaatgacaagtcaaaggagaagtccccaaaatccggtggtgggtcaatttcttgcaagtcatgcagcaagacgttcaacagtgaaatggctctgcaatctcactcgaaggccaagcaccccgccaagtga</cdnaseq>

Protein Sequence

<aaseq>MEFWGLEVKPGQTVKCEPEDERFLHLSQAALGESKKGSDNAVMY VKTDDQKLVIGTLSADKFPQIQFDLVFDKEFELSHTSKTASVFFSGYKVSQPAEEDEM DFDSEEVEDEEEEEKIIPAPRANGKVEGKENEQKKQGKTDSSASKSKAAVNDDDDDDD SDEDDSEDEDLSPEDDDDDSSEDDSSEDDEDESDEEDTPKKPETGKRKVAEIVLKTPS SDKKAKIATPSGQKTGDKKGVHVATPHPAKQASKTPVNDKSKEKSPKSGGGSISCKSC SKTFNSEMALQSHSKAKHPAK</aaseq>

Gene Sequence

<dnaseqindica>2434..2494#2220..2352#2037..2133#1849..1917#1612..1769#1463..1507#1365..1392#1016..1234#845..915#84..96#agccttaaaccctagctccgcctcccacctcccttttcttttctagggttcttccgccgccgccgccgccgccgccgattccgatggagttctggggtaatctcctcctctacctctctctcttcccctccctctctccatccatctatattgcgcagtttcggtttttgtttgatttgatttggacgcgattcgtttgatacggtgtttggttcgtgcgcttctcttcgttacggattagacgcgattcgtttcaccatcgagtgttttgggttcgcgcggaatcgcggccatggctcttccctgtcttcgttagggattaattagggattttagttttcatgggccgcgactatttccatcatacatgcgtaaccgcattggttgccgcctttatgtttgcgagaatcatcattttgttcattctgtttctgtttcagttaacacattctgattatcttcagtctcatagttgttatcatatattactacagtacttaccttgcttcggccccatcgtttggcatatttacgaacgaaaaataatttgtgaataaaacttagcgatctaaaagaaaaggctgaaaaataaacttctgaaaacctccaaaatcaactccaaatttaagattgaaaattcaaattttggctgataagcataagcggaaagataaggtcgcttgtttctatgggccatcctcgttaatttactatgctagttgcttttcaactttactagctaaaggcaaatatgaactgtagtatactgtttcattcatgccttcttggaagggaaggactactctatacatgtgtttttcgctgattagtcaaagttgtgcaggtcttgaagtcaagcctggacagactgtcaaatgtgagcctgaagatgaacgctttttgcacctttctcaggtttattatgttcctcttctgtcctcctttttttgaacagtgaggcttttgtgttctcattgtgtacttaatcttttgttattcaacaattgcttggtaggctgctcttggggaatcaaagaaaggatctgacaatgcagtaatgtatgttaaaactgatgatcaaaagctagtcattggaaccctctcagctgacaagttccctcaaatccagtttgatttggtctttgacaaagagtttgagctgtcacacacttcaaagactgctagtgtgttcttttctggctacaaagtttcccagccggctgaggaagatgaatatcctttgtaatgttttaccatgtttggtcaatatatgtaatgcatataatgtcatactctattttattttcattaaggtatgtattacaatattgttttccttgacctgccttttttgttgttccacaatggattttgattctgaagaagttgaaggtatgattgctactagtgcttgtgttctgcctagagagaatttaacgagcctgtttataatttatttcagatgaagaggaggaagaaaagatcattccagctcccagggcaaatggtaccatagtttctcctttctgattatgattggaatcacagaatccttttgcacctctctttaaaactttataaggaagtacttatgactaaaacttttctaaggcaaagttgaagggaaggaaaatgagcagaaaaaacaaggcaagacagattcttcagcttcaaaatcaaaggctgcagtgaatgacgatgatgatgatgatgacagtgatgaggatgattctgaggacgaagatctttctcctgaggatgatgatgatgtgagtaatttatgggtactgttgtgtattattgtggaggattgttccatactaacagtggtgcaatggcctgttataggattcttctgaggatgattccagcgaagatgatgaggatgagagtgacgaggaagatactcccaagaaggtatgtgtatgtgtttgaaggatatagtctgcttgtttctgtgcacttatatgtgtttgaaggatacagttagtttgtttgttctgtactcttaccataaacaatgtgatgacttgcagccagagactggaaagaggaaagtagctgaaattgtgttgaagacaccttcgtctgataagaaagcaaagattgctacaccgtcaggccagaagacaggttagtagctgtgaagctgcgcctgcgatgaataaattggcactggaagtagtgatgaatttgtatcatttggtcctcctgagcaggtgacaagaagggtgtccatgtagcaactccacatccggcaaagcaggctagcaagacccccgtgaatgacaagtcaaaggagaagtccccaaaatccggtggtgggtcaatttcttgcaagtcatgcagcaagtaagtttagatgcgctgtcttcttgttttggagtattacgtaaggaaatgattcaaagtttgcatgaatgcattgtttaggacgttcaacagtgaaatggctctgcaatctcactcgaaggccaagcaccccgccaagtgaagaatgagacaacggatgctgagctgagaaatattggtgtcgtttgagttggttatctgaaatgaaatgaaatgctgcaaactatttggtgttatgagtagtgtcgtgacggtttatgtggtgcaaactatttagtctagaaaaaaaaaatctgtggtgcgaactgagctacaattttattcggtcaaggtcagtggagtgattggtttattttggatggaattattgttcttccctgttattcggttaattcccacgagaaaggattgataacaccacactgaattgactagctgaacaaagtcg</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0597100, RefSeq:Os05g0597100