Os04g0413500

From RiceWiki
Revision as of 05:58, 17 May 2014 by Yangjanezhen (talk | contribs) (References)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

GIF1 ((grain incomplete filling 1)) plays an important role in crop cultivation which controlling crop grain-filling remain elusive. The cultivated GIF1 gene shows a restricted expression pattern during grain-filling compared to the wild rice allele. Fine mapping with introgression lines revealed that the wild rice GIF1 is responsible for grain weight reduction[2]. The overexpression of GIF1 driven by its native promoter increased grain production. It is suggested that GIF1 is a potential domestication gene and that such a domestication-selected gene can be used for further crop improvement[2]. GIF protein could control rice tissues, including the number of the starch grain. The GIF1 gene in modern cultivated rice is specifically expressed in strict organization which good for grain filling, increasing the yield of rice[2].

Grain-filling and sugar content of gif1 mutant VS. Wild-type rice.

Grain-filling and sugar content of gif1 mutant: The mutant was morphologically normal, with normal seed setting. It showed slower grain-filling than wild-type rice [2].

Wild-type rice: The gif1 mutant also showed markedly more grain chalkiness as a result of abnormally developed and loosely packed starch granules [2].

Expression

1. Wang et al. investigate the site of GIF1 action using a pGIF1- β –glucuronidase (GUS) reporter transgene (pGIF1-GUS). GUS activity was mainly detected in growing roots, the node and the rapidly elongating zone of the internode, similar to its transcript accumulation. Particularly during early grain-filling, strong GUS activity was observed in the ovular vascular trace end of the grain at 3 and 5 DAP. It is proposed that propose that the restricted expression pattern of the GIF1 gene in the ovular vascular trace is the key to increased grain weight. Consistent with our interpretation, transgenic rice plants that ectopically expressed the cultivated GIF1 gene from the rice Waxy promoter also had smaller grains [2]. An extensive microarray survey of gene expression indicates that many genes encoding proteins involved in sugar and energy metabolism have higher expression levels in O. rufipogon than in cultivated rice. The restricted expression pattern of GIF1 in the vascular bundle should facilitate sucrose unloading favoring grain-filling, whereas the wild rice GIF1 allele might promote energy metabolism [2].

2. Wang et al. used microarray analysis to examine the regulation of genes involved in sugar metabolis and proposed that sucrose partitioning is altered by the gif1 mutation, leading to lower sucrose levels in the gif1 grain, as similarly reported for carrot [2].

Knowledge Extension

1. Grain filling is the process of increasing the weight of every grain of Rice. The grain filling is also the aim which proposed by human. Wang et al. made a research of history of this gene, and proved that its promoter region chose to clean in the process of domestication of rice just as the expectation of people[2]. More researches would concentrate this area which would be helpful in using this gene.

2. There is found that GIF1 and OsCIN1 is a pair of duplication which experienced sub-functionalization implies that selection could act independently on each duplicate towards different functional specificity and provided a vivid example for evolution of genetic novelties in a model crop[1]. Differential biological functions of GIF1 and OsCIN1: GIF1: GIF1 is mainly expressed in seed vascular tissues and controls sucrose unloading for starch synthesis at the early grain-filling stage[3]. Overexpression of the GIF1 gene produced plants with marked defects both in grainfilling and development, indicating that over-activity of the GIF1 enzyme disrupts sugar homeostasis, a process important to normal grain and plant development. OsCIN1: OsCIN1 has lower CWI activity compared to GIF1 in the transgenic plants. Consistent with this, no obvious phenotype was observed in CIN1-OE plants except pre-harvest sprouting. Interestingly, OsCIN1 might be involved in pathogen defense and stress response[4]. It has been reported that sugars interact with signaling pathways mediated by phytohormones such as GA and ABA during seed germination and seedling development[5][6], which are also involved in stress responses[1].

Labs working on this gene

1. Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences.

2. China National Rice Research Institute.

3. Zhejiang Academy of Agricultural Sciences.

4. School of Life Sciences, Fudan University.

5. Department of Biology and the Huck Institutes of Life Sciences, Pennsylvania State University, University Park, Pennsylvania.

6. College of Agriculture, South China Agricultural University.

References

[1] Wang E., Xu X., Zhang L., et al. Duplication and independent selection of cell-wall invertase genes GIF1 and OsCIN1 during rice evolution and domestication. BMC Evolutionary Biology 2010, 10: 108

[2] Wang E., Wang JJ., Zhu XD., et al. Control of rice grain-filling and yield by a gene with a potential signature of domestication. Nature Genetics 2008, 40(11): 1370-1374.

[3] Wang ET, Wang JJ, Zhu XD, Hao W, Wang LY, Li Q, Zhang LX, He W, Lu BR, Lin HX, Ma H, Zhang GQ, He ZH: Control of rice grain-filling and yield by a gene with potential signature of domestication. Nat Genet 2008, 40:1270-1274.

[4] Cho JI, Lee SK, Ko S, Kim HK, Jun SH, Lee YH, Bhoo SH, Lee KW, An G, Hahn TR, Jeon JS: Molecular cloning and expression analysis of the cell wall invertase gene family in rice (Oryza sativa L). Plant Cell Rep 2005, 24:225-236.

[5]Lu F, Ammiraju JS, Sanyal A, Zhang S, Song R, Chen J, Li G, Sui Y, Song X,Cheng Z, de Oliveira AC, Bennetzen JL, Jackson SA, Wing RA, Chen M: Comparative sequence analysis of MONOCULM1-orthologous regions in 14 Oryza genomes. Proc Natl Acad Sci USA 2009, 106:2071-2076.

[6]Taylor JS, Raes J: Duplication and divergence: the evolution of new genes and old ideas. Annu Rev Genet 2004, 38:615-643.

Structured Information

Gene Name

Os04g0413500

Description

Similar to Cell wall invertase 2

Version

NM_001059283.1 GI:115458295 GeneID:4335790

Length

4751 bp

Definition

Oryza sativa Japonica Group Os04g0413500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:20444480..20449230

Sequence Coding Region

20444531..20444735,20445379..20445387,20445875..20446755,20447145..20447306,20448058..20448317
,20448426..20448516,20448803..20448991

Expression

GEO Profiles:Os04g0413500

Genome Context

<gbrowseImage1> name=NC_008397:20444480..20449230 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:20444480..20449230 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgggagttcttggtagtagggtcgcttgggcatggctggtccagctgctgctgctccagcagctcgccggagcgtcgcacgtcgtctacgacgacctcgagctgcaggcggctgctaccacagcggacggcgtgccgccgtccatcgtcgactctgagctccggactgggtatcacttccagccacccaagaactggatcaatgatccgaacgcgccgatgtactacaaggggtggtaccatctgttctaccagtacaaccccaagggcgccgtgtgggggaacatcgtgtgggcgcactcagtgtcacgtgacctcatcaactgggtggcgctcaagccggccatcgagcccagcatcagggccgacaagtacggctgctggtcggggtcggcgacgatgatggccgacgggacgccggtgatcatgtacaccggcgtcaaccgccccgacgtcaactaccaggtgcagaacgtggcgctgccgaggaacgggtcggacccgctgctgcgcgagtgggtgaagcccggccacaacccggtgatcgtgcccgagggcggcatcaacgcgacgcagttccgcgacccgaccaccgcgtggcgcggggccgacggccactggcggctgctcgtcggcagcctcgcggggcagtcccgcggcgtggcgtacgtgtaccggagcagggacttccggcggtggacgcgcgcggcgcagccgctgcactcggcgcccacggggatgtgggagtgcccggacttctacccggtcaccgcggacggccgccgcgagggcgtcgacacctcgtccgccgtcgtcgacgccgccgcctcggcgcgcgtcaagtacgtgctcaagaacagcctcgacctgcgccggtacgactactacaccgtcggaacgtacgaccggaaggccgagcggtacgtgccggacgaccccgccggcgacgagcaccacatccgctacgactacggcaacttctacgcctccaagacgttctacgacccggcgaagcgccgccgcatcctctggggatgggccaacgagtccgacaccgccgccgacgacgtggccaagggctgggccggaatccaggcgattccgaggaaagtgtggctggacccaagtgggaagcaactgttgcagtggccaatcgaggaggtcgagaggctgagagggaagtggccggtcattctcaaggacagggtggtcaagccaggggaacacgtcgaggtgaccgggctacaaactgcacaggctgacgtggaggtgagcttcgaggtggggagcctggaggcggcggagcggctggacccggcgatggcgtacgacgcgcagcggctgtgcagcgcgcggggcgccgacgcgaggggcggcgtggggccgttcggcctgtgggtgctcgcgtccgcggggctggaggagaagaccgccgtgttcttcagggtgttcaggccggcggcgcgcggcggcggcgccggcaagcccgtcgtgctcatgtgcaccgaccccaccaagtcatcgcgcaacccgaacatgtaccagccgacgtttgcagggttcgttgacacggacatcaccaacgggaagatatctctgaggagcctgatcgacaggtcggttgttgagagcttcggggctggaggaaaggcgtgcatcctgtcgagggtgtacccgtcgctggccatcggcaagaacgcgcgcctttacgttttcaataacgggaaggcggagatcaaggtgtcgcagctcaccgcgtgggagatgaagaagccggtcatgatgaatggagcctaa</cdnaseq>

Protein Sequence

<aaseq>MGVLGSRVAWAWLVQLLLLQQLAGASHVVYDDLELQAAATTADG VPPSIVDSELRTGYHFQPPKNWINDPNAPMYYKGWYHLFYQYNPKGAVWGNIVWAHSV SRDLINWVALKPAIEPSIRADKYGCWSGSATMMADGTPVIMYTGVNRPDVNYQVQNVA LPRNGSDPLLREWVKPGHNPVIVPEGGINATQFRDPTTAWRGADGHWRLLVGSLAGQS RGVAYVYRSRDFRRWTRAAQPLHSAPTGMWECPDFYPVTADGRREGVDTSSAVVDAAA SARVKYVLKNSLDLRRYDYYTVGTYDRKAERYVPDDPAGDEHHIRYDYGNFYASKTFY DPAKRRRILWGWANESDTAADDVAKGWAGIQAIPRKVWLDPSGKQLLQWPIEEVERLR GKWPVILKDRVVKPGEHVEVTGLQTAQADVEVSFEVGSLEAAERLDPAMAYDAQRLCS ARGADARGGVGPFGLWVLASAGLEEKTAVFFRVFRPAARGGGAGKPVVLMCTDPTKSS RNPNMYQPTFAGFVDTDITNGKISLRSLIDRSVVESFGAGGKACILSRVYPSLAIGKN ARLYVFNNGKAEIKVSQLTAWEMKKPVMMNGA</aaseq>

Gene Sequence

<dnaseqindica>52..256#900..908#1396..2276#2666..2827#3579..3838#3947..4037#4324..4512#atcctcctctcctcttctcgctctcacttcttgtgcccaagtgtgagagcaatgggagttcttggtagtagggtcgcttgggcatggctggtccagctgctgctgctccagcagctcgccggagcgtcgcacgtcgtctacgacgacctcgagctgcaggcggctgctaccacagcggacggcgtgccgccgtccatcgtcgactctgagctccggactgggtatcacttccagccacccaagaactggatcaatggtaatgtgaactaactgaaatgttgccaacttgccattgttcatgccagaacgccggtcaggccgtatgatttgcaggtcatagggcaccacttgtggttgtggatactggatagatgagcaaagggaacagagtgctctgttcttgagaattgagacgcagaatcgtgcagagtaactagtacagttttgacgacgttgttgtgtagaacatcacctgaactaaatggctcaacttgagtaatttatagtcagagttgaaaatattgacatcatagtcatatcaaatgtttggcacacaacataaattacggacagtacactaaggcatcagtttttatgtccattttgtcgggtcagctagtagagtcaacgttagcacccacgcggtcacgctgaaagaagtagcttcagaagcatctcacagtaaactactgagagtttgccatctctttttcatgaagctcacacttagtcccttcgaactgttaacagatgtactaccttgttctacttttcttgctaatgattcttgtgacaaggcttagtcctaaccggcaattttcttgtgcaattatttggtgggggtgtgctctgctctacactgtgattgctgctgcgtcatcaacattggaaacccgcagatccgaacggtacgtcgttttcccaccctttataatatatcctgtcacgaatctctgtctactagtagtagtagtagtagtactagaacttttatgccttgcaacttgcaatttcgttgtacgggagaggactgtagttagtgacgcctttcatggtaggattaaaggttcaaagcacattttagcacgaaaatggtaggcgcactgggactccacatgcaggcttgcttgtcgaccgtggggtacctagcccctaccacggctgatgaccacaaagttcagaaaatcttaacttcctctcagaaagggaattagccaaaagttcacctttttctcgtacgaaatgaagcatctatagttctataattaatcgtgagcagtgtagagaaaaatgcaatgtacacgcgcgattaaactgaaatggtaattgatttcaatgtactactaagactgaagatcatttcttgatttggtgaaactgaacgggtgcatgcagcgccgatgtactacaaggggtggtaccatctgttctaccagtacaaccccaagggcgccgtgtgggggaacatcgtgtgggcgcactcagtgtcacgtgacctcatcaactgggtggcgctcaagccggccatcgagcccagcatcagggccgacaagtacggctgctggtcggggtcggcgacgatgatggccgacgggacgccggtgatcatgtacaccggcgtcaaccgccccgacgtcaactaccaggtgcagaacgtggcgctgccgaggaacgggtcggacccgctgctgcgcgagtgggtgaagcccggccacaacccggtgatcgtgcccgagggcggcatcaacgcgacgcagttccgcgacccgaccaccgcgtggcgcggggccgacggccactggcggctgctcgtcggcagcctcgcggggcagtcccgcggcgtggcgtacgtgtaccggagcagggacttccggcggtggacgcgcgcggcgcagccgctgcactcggcgcccacggggatgtgggagtgcccggacttctacccggtcaccgcggacggccgccgcgagggcgtcgacacctcgtccgccgtcgtcgacgccgccgcctcggcgcgcgtcaagtacgtgctcaagaacagcctcgacctgcgccggtacgactactacaccgtcggaacgtacgaccggaaggccgagcggtacgtgccggacgaccccgccggcgacgagcaccacatccgctacgactacggcaacttctacgcctccaagacgttctacgacccggcgaagcgccgccgcatcctctggggatgggccaacgagtccgacaccgccgccgacgacgtggccaagggctgggccggaatccaggtaattaaccgcacgtcctgactgcatacgtgcatgccatttacgtgtccaccatgcatgctgccatcttcagatagtcaatatcaccatatactccctccgttctaaaatgtttaacaccattgactttttagcacatgtttgaccgttcgtcttattaaaaaaatatgaaatatataaaactatatgtatacataaaagtatatttaacaatgaatcaaatgatatgaaaagaacaaataattacttaaattttttgaataagacgaatggtgtcaagtattttgaaaaaagagagtatatcttaaaagtcaaatggaacaacactagcagctcaattttgctggtaatctttgattgaatcgtgtgtttgtgatgtgatgttttaggcgattccgaggaaagtgtggctggacccaagtgggaagcaactgttgcagtggccaatcgaggaggtcgagaggctgagagggaagtggccggtcattctcaaggacagggtggtcaagccaggggaacacgtcgaggtgaccgggctacaaactgcacaggtattcctttttgcatctgtaattctgtaaaactattttttttaccccaaaagggcattcgaataaaactgctcacacatccatggttctgtgcatgacagtagtaattattaataagttatcctgtttgttttgctgtgtcctggaccgatctttatcttatctggcacgcctgaagttgtgtccagtgtgcagtgcccactgaacaccacctactacgtgtgccgtgtcgctttcttctcgtccccttttaccatctcctgcacactttgctcgtacttaactgatctcactgattctctcgtcatccgcgcatgtcacgtacaacttccaggttgcagcgtgattagtgcacatatcactaagacactaaacaacataattagagagatagttaaggagctcaattaatgtgctttgttggtgacgtacgtgagtaggagctgtgatctctgatagcaagtttaatagtatagctaactactggctctaaattatctatagtcaatctaataataaattcatataatagttacctataaacatatactaaataattaatacatggttccacatgtcatacacatatgcatcttaaagtccgtactataatttgctgtaaatctatagcttgttgtttttctctctcctcttttatctcctcgatcgaaatgtgtttatagctggcttatagtgtgctattgtccctggtctgatgaagtgatcatgcattctgtttggtggggtgcaggctgacgtggaggtgagcttcgaggtggggagcctggaggcggcggagcggctggacccggcgatggcgtacgacgcgcagcggctgtgcagcgcgcggggcgccgacgcgaggggcggcgtggggccgttcggcctgtgggtgctcgcgtccgcggggctggaggagaagaccgccgtgttcttcagggtgttcaggccggcggcgcgcggcggcggcgccggcaagcccgtcgtgctcatgtgcaccgaccccaccaagtacgtgcggcttttgcactttatcggtgattgatcgcactacacaataaacaaaatattgccttgactccgtttactgattttttggtatggtgcgtatgcgtgcaggtcatcgcgcaacccgaacatgtaccagccgacgtttgcagggttcgttgacacggacatcaccaacgggaagatatctctgaggagcctggtacgtaataggaccaaattatcgggaaaaaaggaaaatgttgcatgacggtatcccgttcggataaaattatacctcttaaatattgtccgatacctaataaatattaattggctaataaactatttgaatgggatgatatctttgaggtatcgtctgatacctatctgataggtacctcataggtatcacctcgtccgaacgggttactgttttataacattcatctggaaaaggttcataaattgtagaatatgttttgatatcttgtgtctctcttgtgcagatcgacaggtcggttgttgagagcttcggggctggaggaaaggcgtgcatcctgtcgagggtgtacccgtcgctggccatcggcaagaacgcgcgcctttacgttttcaataacgggaaggcggagatcaaggtgtcgcagctcaccgcgtgggagatgaagaagccggtcatgatgaatggagcctaaacaatatttgaaattgagagagatagatgcaatgcatgatgagaactaccttcagtagctagctagatttttgagtttcagcggaaaagaaaaaactgattgcccttaattatgtgctaaatcatgcccccttgtgtaaaatggtttcagtcacacgtgtcgtatgcatatgtaccaaggggacagtttgaatgcatggatgccattaggactaataaagattgatgctagtataaccc</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0413500, RefSeq:Os04g0413500