Os01g0759400

From RiceWiki
Revision as of 15:52, 28 January 2015 by Zhangye (talk | contribs)
Jump to: navigation, search

OsCIPK12 is a member of CIPK genes (CIPKs,calcineurin B-like protein interacting protein kinases)[1].

Annotated Information

Function

  • OsCIPK12-overexpressing transgenic plants accumulated significantly higher contents of proline and soluble sugars than the wild type. Putative proline synthetase and transporter genes had significantly higher expression level in the transgenic plants than in the wild type. The differentially induced expression of OsCIPK genes by different stresses and the examples of improved stress tolerance of the OsCIPK transgenic rice suggest that rice CIPK genes have diverse roles in different stress responses and some of them may possess potential usefulness in stress-tolerance improvement of rice[1].
  • Interestingly, five OsCIPK genes, OsCIPK1, OsCIPK2, OsCIPK10, OsCIPK11 and OsCIPK12, were transcriptionally up-regulated after bacterial blight infection[1][3].

GO assignment(s): GO:0004672,GO:0004674, GO:0006468, GO:0005524, GO:0007165

Mutation

Figure 1. dentification and drought-tolerance testing of OsCIPK12-overexpressing rice.(from reference [1]).
  • A total of 27 independent transgenic plants were generated for the OsCIPK12 overexpression construct. Among them, 15 plants showed overexpression of the gene, as determined by RNA gel-blot analysis (Fig. 1A).
  • At least 20 hygromycin-resistant transgenic seedlings with similar plant height and vigor as the wild type (Fig. 1B) for each of six OsCIPK12-overexpressed T1 families were selected for drought-resistance testing at the vegetative stage[1].
  • Under drought stress, OsCIPK12-overexpressing plants (three independent lines were tested) accumulated Pro and soluble sugars much quicker than wild-type plants. After water withholding for 6 d, transgenic plants accumulated approximately 7-fold higher content of Pro and 5-fold higher content of soluble sugars compared to the contents of Pro and sugars before drought stress. Such increases were significantly higher than that in wild-type plants, in which Pro and soluble sugars were increased less than 3-fold after drought stress[1].

Expression

  • With water withheld for 1 week, only a few plants of the transgenic families showed slight leaf-rolling, while almost all leaves of the wild type became rolled or withered.After recovery for 3 d, only about 30% of wild-type plants survived, whereas most of the transgenic plants (62.7% to 87.4%) survived quite well (Fig. 1C)[1].
  • The survival rates of the six transgenic families were significantly higher than the survival rate of the wild type (Fig. 1D)[1].
  • Overexpression of OsCIPK12 could increase the drought tolerance of rice at the vegetative stage. Xiang et al. also tested the salt and cold tolerance of OsCIPK12 transgenic plants, but no significant effect on improving tolerance to these two stresses was detected (data not shown)[1].
  • OsCIPK12:OsCIPK30 is tandem duplication[1]. The pair of genes (OsCIPK30:OsCIPK12) depicting neo-functionalization because expression pattern was very divergent, exactly opposite for most of the tissue and condition tested[4].

Evolution

There are four numbers in subgroup IV: OsCIPK12, OsCIPK13, Os-CIPK19, and OsCIPK25. In subgroup IV, OsCIPK12 and OsCIPK19 were the candidate genes showing circadian regulation, and in the WT both genes showed redundant circadian expression patterns[2].

Knowledge Extension

  • Calcineurin B-like protein-interacting protein kinases(CIPKs) are a group of typical Ser/Thr protein kinases that mediate calcium signals. Some genes in the CIPK family of rice are involved in the responses to multiple abiotic stresses, whereas some genes of the family are responsive to specific stresses[1].
  • The calcineurin B-like protein–CBL-interacting protein kinase (CBL–CIPK) signaling pathway in plants is a Ca2+-related pathway that responds strongly to both abiotic and biotic environmental stimuli. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells[5].
  • As a plant-specific Ca2+ sensor relaying pathway, the CBL–CIPK pathway has some crosstalk with other signaling pathways. In addition, research has shown that there is crosstalk between the CBL–CIPK pathway and the low-K+ response pathway, the ABA signaling pathway, the nitrate sensing and signaling pathway, and others[5].

Labs working on this gene

  • National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China
  • Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
  • Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea

References

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
  2. 2.0 2.1 Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
  3. 3.0 3.1 CHEN X, GU Z, LIU F, et al. Molecular Analysis of Rice CIPKs Involved in Biotic and Abiotic Stress Responses[J]. Chinese Journal of Rice Science, 2010, 6: 003.
  4. Kanwar P, Sanyal S K, Tokas I, et al. Comprehensive structural, interaction and expression analysis of CBL and CIPK complement during abiotic stresses and development in rice[J]. Cell Calcium, 2014.
  5. 5.0 5.1 Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J]. Plant cell reports, 2014, 33(2): 203-214.

Structured Information

Gene Name

Os01g0759400

Description

OsPK7

Version

NM_001050846.1 GI:115440062 GeneID:4325613

Length

5052 bp

Definition

Oryza sativa Japonica Group Os01g0759400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:33699375..33704426

Sequence Coding Region

33700652..33700715,33702779..33704337

Expression

GEO Profiles:Os01g0759400

Genome Context

<gbrowseImage1> name=NC_008394:33699375..33704426 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:33699375..33704426 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgctgatggcgaccgtctcgccggcgcggagggagccgacgccgcaggcggtgcgggcgtccccgatgccatcggcggcggcggcgttggtgaggagaggcggtggtggtagcggggggacggtgctggggaagtacgagctggggcgcgtcctgggacagggctcgttcgcgaaggtgtaccaggcgaggcacctggagaccgacgagtgcgtggcaatcaaggtgctcgacaaggagaaggccgtgaagggcgggatggtccacctcgtcaagcgcgagatcaacgtgctccgccgggtgcgccacccgaacatcgtgcagctgttcgaggtaatggccagcaagaccaagatctacttcgtcatggagtatgtccgcggcggcgagctcttctcccgcgtctccaagggacgcctcagggaggacaccgcgcggcgctacttccagcagcttgtctccgccgtcgacttctgccacgcccgcggcgtgttccaccgtgacctcaagcccgagaacctcctcgtggatgagaacggggacttgaaggtctcggacttcggcctcgccgccggccccgaccagttcgaccccgacggtctgctccacacgttctgcggcacgccggcctacgtcgcccccgaggtgctcaggcgccgcggatacgacggcgccaaggcggacatatggtcatgcggtgtcatcctctttgcgctcatggccgggtacctccctttccatgaccacaacatcatggttctgtaccggaagatctacaatggggagttcaggtgtccaaggtggttctccaaggattttactagattgataacgcgccttcttgacgcaaaccccaaaactaggatcaccgtgccagagatcattgagagcgattggttcaagaaaggatacaagccagtcaagttttacattgaggatgacaagctctacaacctgtctgatgacgtgctgaacttggagcctgctgatcctgttcccccaccattgggtttggcacctcctgttcctccacctccacaaggggatgatcctgatggttcagggtctgagtcagattcatcagtcgtatcctgcccggccacattgtcaactggggagagccagagagtccgtgggtcactaccacgcccagcaagccttaatgcatttgatatcatatcattctcaaaaggattcaacttgtctgggctgtttgaggagagggggaacgagatcaggtttgtatctggtgagcccatgtctgacattgtaaaaaagctggaggagattgcaaaggtcaagagcttcacagtgcggaggaaggactggcgggtgagcatagagggtacacgcgaaggagttaaggggcctctaaccataggcgcggagatatttgagcttacaccctcccttgtagtagtggaagtaaaaagaaaggcaggtgataatgaagagtatgaggatttctgcaacatggagttgaagccaggaatgcagcaccttgtgcaccagatgctcccagctccaaatggaactcctgtgagtgagaaggttgaaaggtcttcaagcttacaggctcccctcaccctgaagttgataggaacagaaggcagcatgagctag</cdnaseq>

Protein Sequence

<aaseq>MLMATVSPARREPTPQAVRASPMPSAAAALVRRGGGGSGGTVLG KYELGRVLGQGSFAKVYQARHLETDECVAIKVLDKEKAVKGGMVHLVKREINVLRRVR HPNIVQLFEVMASKTKIYFVMEYVRGGELFSRVSKGRLREDTARRYFQQLVSAVDFCH ARGVFHRDLKPENLLVDENGDLKVSDFGLAAGPDQFDPDGLLHTFCGTPAYVAPEVLR RRGYDGAKADIWSCGVILFALMAGYLPFHDHNIMVLYRKIYNGEFRCPRWFSKDFTRL ITRLLDANPKTRITVPEIIESDWFKKGYKPVKFYIEDDKLYNLSDDVLNLEPADPVPP PLGLAPPVPPPPQGDDPDGSGSESDSSVVSCPATLSTGESQRVRGSLPRPASLNAFDI ISFSKGFNLSGLFEERGNEIRFVSGEPMSDIVKKLEEIAKVKSFTVRRKDWRVSIEGT REGVKGPLTIGAEIFELTPSLVVVEVKRKAGDNEEYEDFCNMELKPGMQHLVHQMLPA PNGTPVSEKVERSSSLQAPLTLKLIGTEGSMS</aaseq>

Gene Sequence

<dnaseqindica>3712..3775#90..1648#ggtacagagcagaggaggggggagagagagagagagagagagagagagagagtcgtgtgtgcgtgtgtccccggggttctagctttgggatgctgatggcgaccgtctcgccggcgcggagggagccgacgccgcaggcggtgcgggcgtccccgatgccatcggcggcggcggcgttggtgaggagaggcggtggtggtagcggggggacggtgctggggaagtacgagctggggcgcgtcctgggacagggctcgttcgcgaaggtgtaccaggcgaggcacctggagaccgacgagtgcgtggcaatcaaggtgctcgacaaggagaaggccgtgaagggcgggatggtccacctcgtcaagcgcgagatcaacgtgctccgccgggtgcgccacccgaacatcgtgcagctgttcgaggtaatggccagcaagaccaagatctacttcgtcatggagtatgtccgcggcggcgagctcttctcccgcgtctccaagggacgcctcagggaggacaccgcgcggcgctacttccagcagcttgtctccgccgtcgacttctgccacgcccgcggcgtgttccaccgtgacctcaagcccgagaacctcctcgtggatgagaacggggacttgaaggtctcggacttcggcctcgccgccggccccgaccagttcgaccccgacggtctgctccacacgttctgcggcacgccggcctacgtcgcccccgaggtgctcaggcgccgcggatacgacggcgccaaggcggacatatggtcatgcggtgtcatcctctttgcgctcatggccgggtacctccctttccatgaccacaacatcatggttctgtaccggaagatctacaatggggagttcaggtgtccaaggtggttctccaaggattttactagattgataacgcgccttcttgacgcaaaccccaaaactaggatcaccgtgccagagatcattgagagcgattggttcaagaaaggatacaagccagtcaagttttacattgaggatgacaagctctacaacctgtctgatgacgtgctgaacttggagcctgctgatcctgttcccccaccattgggtttggcacctcctgttcctccacctccacaaggggatgatcctgatggttcagggtctgagtcagattcatcagtcgtatcctgcccggccacattgtcaactggggagagccagagagtccgtgggtcactaccacgcccagcaagccttaatgcatttgatatcatatcattctcaaaaggattcaacttgtctgggctgtttgaggagagggggaacgagatcaggtttgtatctggtgagcccatgtctgacattgtaaaaaagctggaggagattgcaaaggtcaagagcttcacagtgcggaggaaggactggcgggtgagcatagagggtacacgcgaaggagttaaggggcctctaaccataggcgcggagatatttgagcttacaccctcccttgtagtagtggaagtaaaaagaaaggcaggtgataatgaagagtatgaggatttctgcaacatggagttgaagccaggaatgcagcaccttgtgcaccagatgctcccagctccaaatggaactcctgtgagtgagaaggttgaaaggtaatgattctctcctgattttacttatatgcattgtagctaaatagggaagcaaggattttgtgttgtttaacatgcgcaaccgggcagaaagttaaattgattgatgcttcagttccaataattacataacaatgtttcacttcttgactatacatcctgtatttcaaattgagcgttcaagagtttgtttgctaaaagttaattgatttttattcatgctatttgtttttgttaacgtatgtttaattcacaatcatgcctattgcctaataccagtatgtagaaggaattagatttccttgcacggacacaatttaaagtaggaaagccttgcaattgaaaacctcgaacaactggaacttttattatttctagagtggtgaaagaatgctataggttttgctgttagattttgccaaccattaactagcttgcctcctgcaatccaatttcacagcgcttggataatgcgtatgtctggaaatttgctgccacttgaccattgcaagtgtgcttcgtgaaaagaagcaaatttgaatggttctaatcatcctagtttgtggctgttaaactgattatagattgttttgtttcattctagagcatgatttggtttatctaacatctgtgctcttttaatctatgctacgaactcaatttttcgtaaaatctttcccgcaccctattcttatggactttttagcttgtgatagattgtataagataaatgtcttttctagtcatcagttaatgaaaacattttcgcttgtcttatctatcttttggagttactttaaaaagtgattatgcactgttctactgcaccttagcttgtaaacttcctgctcttatttatttttctttatgtttccattttttttggataatggaattcaatccagtattgatgatgattccatgttaccccagcatttattggtgttgaatgtttacatgtgtcataattcatattgaaaaaacttttgaaaacaaatatagaaaggaaccgccaatatcatgtccttctggtttccccattgttgttatcaccaacttccatggattggcattgtgctgcacatcagcatatgggatagaatgggagcttgaagggaatgcttggcagtacctccgagtaccgaaatgtcatttttacaaagaacatgtgcttcactagattttcagcatgctaggtaaatgttgaaagtgctgtataggtttattatctggtgtagctccctctgacatagtaataacaggttgctttatgggaaacctggtagattttatctatttaatttggtgaaaccatgaaaatgcaaacatcatggctgagacattgaaaattacaaaacagaaagggcgcatagcaacaccatatactattcatgcaaaccatttctactattttaacctgtgagtttttgatggtttctagtttctttttacattcaaatgggctctaattcctgattttaggaggttcctttcttttcagtttcattgctgttattgataaattatcttttttttcattaatgataactttatactttgatggatctttgttgaacacttaatctggtgcacatgttagccacccaccattataggagaacacatgggacacatttaccttcagaggtaaggagggttatgtgcgtaagctgtgcctcggaggtagataggtgtgtttccagaagactttttgttacatttgtcaacctaattttcctccatcggagtagtacattctgtactgcgcaatactagcatcagttaggaaagttggttcaaatatgctccatggtacgtgggtgtacctggagctgttctgtagtcttgttttgaatcttcaatttaccttgaagaattttgcttttgccagtgaactgttatagtccatttgaattgtttgaaatgctactacaaccggaaactattgctttggttctcatagttcagaactcaataggaaatagaagtctattgctgttattacatacaagtgtgataagactaacagactgacatttgattatttccttcttgtcctgcaggtcttcaagcttacaggctcccctcaccctgaagttgataggaacagaaggcagcatgagctagagacaggagcttccatgcagttgacagggagatctcttttaccggaccaaacctgaccggtctggttcccgttgatgagctcgtggttttgataactagcaagagttctctttctctggatggcctaagatcgtttttaggcaatggatcgagacagtggatgtagatactccggttgtggatggtgcccaggtgggcgtttaaagtggatgtagataccctggttgtggtggtgcccaggtgggcgtttaaagtggattgtactggccagttttctctcgacttagcggctgtgtgcatctgcggtttggtttctttggcagcatcgaataattttgtggtaaccatgattctggtcgggggacagttgattgaggtatgggagggatatgcatgagccgggcatgtgccgaccgattggattccgaatcttccattcctgatgccattagcccattattggatgcgaggtgacagatttgggcactgcagtgcggttggttggttggggcctgtggggactgggggtcgagattacttggacctgctgtgctgcagcggctttggctgaggtcaccgagcacgtgagagcatcggtgggtggcatggttggcctaccccggcagtggtggcggccggctcgggccacgagagcgccgcgccgtttgtggtggcgcacggctctgcagtcggcggcgggcccgttgttgcgcatttccgtgataaagatcaccgtggtatgtcgtattctgttatacaatgctctttttgtggattcgaacttcgaatatggagttatggacacgggtggtcatcgatggagacaacagtggcgaaccggcgatttcatatggctcagtgagatgctttaaggtacataacaatttgaggtatgcattcatttaatcatgacatggcatgattaaccttggatttgtgtgaaagctatcactataacgacctgtactcttggtgatattccccaccgtgccaatttcctggtatctacactcctcaacggatatgtcgtggaaatgcagcatttctaacccaacagatacagggatcatatttcatcctacaaagattatgtgaaagagatcagcataataatggaaatacgcttaaaaagtaaaatcatgaaaattccatgtgatagttaggatcgacaatgacaatgattataatcatatcacaatataagatatagcctattgtaatataagaatttgatgctctgttttataatgttactacctctttacttcttgtttttg</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0759400, RefSeq:Os01g0759400