Os11g0113700

From RiceWiki
Revision as of 14:09, 18 May 2014 by Kangkelai (talk | contribs) (Annotated Information)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

This gene encodes a protein kinase, the calcineurin B-like interacting protein kinase 15 (CIPK15), which is a key regulator of the sensing cascade for successful rice germination under flooding (Lee et al. 2009). CIPK15 regulates the plant global energy and stress sensor SnRK1A (Snf1-related protein kinase 1) and links O2-deficiency signals to the SnRK1-dependent sugar-sensing cascade to regulate sugar and energy production and to enable rice growth under floodwater. CIPKs are a group of plant-specific Ser-Thr protein kinases containing a conserved 24-amino acid motif, called the NAF (Asn-Ala-Phe) domain, which is in the C-terminal nonkinase region and is sufficient and necessary for CIPK interaction with Calcineurin B-like (CBL) proteins. The Arabidopsis CBL-CIPK network consists of 10 CBLs and 25 CIPKs that act in combination with one another, and different pair combinations have been found to participate in signaling pathways related to abiotic stresses, including salt, drought, osmotic, cold, and ABA (abscisic acid). The current works show that CIPK15 integrates sugar- and O2-deficiency signaling processes relevant to germination and seedling growth under floodwater and in mature plants grown under partial flooding. Under O2 deprivation, the CIPK15 pathway is repressed in the tolerant, Sub1A-containing, FR13A variety. CIPK15 is likely to play a role in the up-regulation of Ramy3D in flooding-intolerant rice varieties that display fast elongation under flooding and that do not possess Sub1A. OsCIPK14 and OsCIPK15, which are rapidly induced by MAMPs, involved in various MAMP-induced immune responses including defense-related gene expression, phytoalexin biosynthesis and hypersensitive cell death. MAMP-induced production of reactive oxygen species as well as cell browning were also suppressed in OsCIPK14/15-RNAi transgenic cell lines. OsCIPK14/15 play a crucial role in the microbe-associated molecular pattern-induced defense signaling pathway in rice cultured cells.

Mutation

Nipponbare mutant line: A Tos17 insertion in ATG downstream, which turns to be hypersensitive to the effect of anaerobic germination under water. O. sativa FR13A variety: Sub1A-containing variety whose CIPK15 pathway is repressed under O2 deprivation.

Expression

OsCIPK14/15 interacted with several OsCBLs through the FISL/NAF motif in yeast cells and showed the strongest interaction with OsCBL4. The recombinant OsCIPK14/15 proteins showed Mn2+-dependent protein kinase activity, which was enhanced both by deletion of their FISL/NAF motifs and by combination with OsCBL4. OsCIPK14/15-RNAitransgenic cell lines showed reduced sensitivity to TvX/EIX for the induction of a wide range of defense responses, including hypersensitive cell death, mitochondrial dysfunction, phytoalexin biosynthesis, and pathogenesis-related gene expression. On the other hand, TvX/EIX-induced cell death was enhanced in OsCIPK15-overexpressing lines. In adult plants Sub1A and CIPK15 may perhaps play an antagonistic role in terms of carbohydrate consumption, with Sub1A acting as a starch degradation repressor and CIPK15 as an activator.

Evolution

Arabidopsis thaliana genome sequence revealed 10 CBL and 25 CIPK homologues (Luan et al., 2002). OsCIPK14/15 showed 44% homology with AtCIPK24/SOS2 at the amino acid level (Liu et al., 2000). Amino acid sequences of the N terminus of the kinase domain and the FISL/NAF motif (Albrecht et al., 2001) were especially well conserved.


You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os11g0113700

Description

Similar to Protein kinase PK4

Version

NM_001072106.1 GI:115483824 GeneID:4349594

Length

3038 bp

Definition

Oryza sativa Japonica Group Os11g0113700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:629588..632625

Sequence Coding Region

629886..631190

Expression

GEO Profiles:Os11g0113700

Genome Context

<gbrowseImage1> name=NC_008404:629588..632625 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008404:629588..632625 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagagtagagggaagattctaatggagaggtatgagttggggagattgttggggaaaggaacatttggcaaggtgcactatgcaaggaatctggagtcaaaccagagtgtggccataaagatgatggacaaacagcagatattgaaggtcgggctttcggagcagatcagacgtgagatcacaaccatgcggttggtggctcataagaacattgttcagcttcatgaggtcatggcaacacggaacaagatctactttgtgatggagtatgtgaaaggtggtgagctatttgaaaaggttgcaaagcgtggaaagcttacagaggttgttgcacataagtatttccagcaactcattagtgcagtggattactgccacagtcgaggtgtgtatcaccgggacttgaagcctgagaacctactgttggatgagaatgagaacctgaaagtctcagactttggattgagtgcgctttcagagtcgaagaggcaagatggcttactccataccacctgtggaacacctgcatatgtagctccagaggtgattagcaagataggctatgatggtgcaaagtcagatatttggtcttgtggtgttatcctgtttgttcttgttgctggttaccttcctttccagggcccaaacttgatggaaatgtatcggaagatacaacacggtgaattcaggtgccccggttggttttcacgcaaactccagaagttgttgtacaagatcatggaccccaacccaagcacaaggatttcaatccagaagataaaggagtctacctggttccggaaaggtcctgaggagaaccgtattttgaaggaaagaactttgaatgaaaacaccaccaaaaatgttgctccggtgcttggtgtgagacgcaagaaaaatgctcatgaagatgtgaagcccatgtcagtgacaaacttaaatgcttttgaaattatctctttctccaagggatttgatctctctggcatgttcattgtaaaggaatggagaaatgaggcaaggttcacttcagataaatctgcctcaaccataatctcaaagctagaagatgtagcaaaggcgctaaatctcagggtaaggaagaaagacaatggtgtagtgaagatgcaagggaggaaggagggaaggaatggtgttcttcagtttgacatagagatatttgaggttaccacttcctatcatatcatcgagatgaaacaaacaagtggcgattcattggagtaccgacagctactggaggagggcatccggccagctctgaaggacattgtcttggcctag</cdnaseq>

Protein Sequence

<aaseq>MESRGKILMERYELGRLLGKGTFGKVHYARNLESNQSVAIKMMD KQQILKVGLSEQIRREITTMRLVAHKNIVQLHEVMATRNKIYFVMEYVKGGELFEKVA KRGKLTEVVAHKYFQQLISAVDYCHSRGVYHRDLKPENLLLDENENLKVSDFGLSALS ESKRQDGLLHTTCGTPAYVAPEVISKIGYDGAKSDIWSCGVILFVLVAGYLPFQGPNL MEMYRKIQHGEFRCPGWFSRKLQKLLYKIMDPNPSTRISIQKIKESTWFRKGPEENRI LKERTLNENTTKNVAPVLGVRRKKNAHEDVKPMSVTNLNAFEIISFSKGFDLSGMFIV KEWRNEARFTSDKSASTIISKLEDVAKALNLRVRKKDNGVVKMQGRKEGRNGVLQFDI EIFEVTTSYHIIEMKQTSGDSLEYRQLLEEGIRPALKDIVLA</aaseq>

Gene Sequence

<dnaseqindica>1436..2740#gcatccactcctgatactaccactcaaaaactctctctctctacccaaacaggtgttgagaaagaagtgagggacagatccaaaaagttcaccttttgttacctgaatctcctcttcttcctgtcaccggaaggtatgcagttcctctctccatatcatcttctagcgtttctttctactgattcttgattgctcgcttttttccattattctcttttgctccaaggtaggggtaggggcacatcagttggacaagtagaaattgatggcacatcaattgagtagatgcggaaatttatggtttttagttaaagtttagaccaagccgatgacaaagtgctgccgtttaatcgaatacgacgatatgtactcttgcaatggcatgtgtcatgaggtgtttgggtttggcgaggctcagttttcattaatttcccctccttcccatggccgtatcaaacctaatctttgaaaaatattcaattcatgtgggtgcggaatcactagatgcagcttaactccatgcaaatcctaactcctgccatgtgcccatgtgcctgtcccttatcctgatttgcatctgaattcatttgctgagtaatttgcttgttcagtgcctaatctgctagacgtccaaacaaagttttaattatgagcaaaagatctagtaatgtcattttttctaaattcgtaatgttttggtctctgaattcgtaattgactagttttattaatcacctttctgaacttgaacgaaagatgtagaataattcacatcggttgcaaattttaattcgtaattgactagttttattttgttagcttctgatttactgtcctagatttctgataagtacttagttgaagttccttattatattaattatctattacataacacgttgaactcatgtaagttctgattgattctagggaacacttatattatataagtagtaggtacaaaaatgcatttagtattacaataagccttcaaaattcttcgcattaacttttgtttggttaaagttcttacagactttcagattattatacgtaccttgttagcacttgagtgcatatcctaggacattcaattactaaatctgatgcctggttttgtttatacaggggaatcaataaaaaaaacaagcagtgaaagcctcaaggaatgctgaaagatgtgcttgcatagaagaaattttccgtgtgagataaaacagattgctggttcaccagtgctactgatctactcaagtcttgatgtgagtgatcaactttcctgcactaattctacaccatttagactccgaaacgacgatgatataagaatgttgttctccatccacgatcatgaccttggggaggatggctaaagaattgcagtccatctgattggtggtcaaaacatagtgctgagatttatatctttgtgggcatggagagtagagggaagattctaatggagaggtatgagttggggagattgttggggaaaggaacatttggcaaggtgcactatgcaaggaatctggagtcaaaccagagtgtggccataaagatgatggacaaacagcagatattgaaggtcgggctttcggagcagatcagacgtgagatcacaaccatgcggttggtggctcataagaacattgttcagcttcatgaggtcatggcaacacggaacaagatctactttgtgatggagtatgtgaaaggtggtgagctatttgaaaaggttgcaaagcgtggaaagcttacagaggttgttgcacataagtatttccagcaactcattagtgcagtggattactgccacagtcgaggtgtgtatcaccgggacttgaagcctgagaacctactgttggatgagaatgagaacctgaaagtctcagactttggattgagtgcgctttcagagtcgaagaggcaagatggcttactccataccacctgtggaacacctgcatatgtagctccagaggtgattagcaagataggctatgatggtgcaaagtcagatatttggtcttgtggtgttatcctgtttgttcttgttgctggttaccttcctttccagggcccaaacttgatggaaatgtatcggaagatacaacacggtgaattcaggtgccccggttggttttcacgcaaactccagaagttgttgtacaagatcatggaccccaacccaagcacaaggatttcaatccagaagataaaggagtctacctggttccggaaaggtcctgaggagaaccgtattttgaaggaaagaactttgaatgaaaacaccaccaaaaatgttgctccggtgcttggtgtgagacgcaagaaaaatgctcatgaagatgtgaagcccatgtcagtgacaaacttaaatgcttttgaaattatctctttctccaagggatttgatctctctggcatgttcattgtaaaggaatggagaaatgaggcaaggttcacttcagataaatctgcctcaaccataatctcaaagctagaagatgtagcaaaggcgctaaatctcagggtaaggaagaaagacaatggtgtagtgaagatgcaagggaggaaggagggaaggaatggtgttcttcagtttgacatagagatatttgaggttaccacttcctatcatatcatcgagatgaaacaaacaagtggcgattcattggagtaccgacagctactggaggagggcatccggccagctctgaaggacattgtcttggcctagcatggagatgaatagcagcagtcgcaagagtagattttgatgtctcaagcatttagtttccgctcctcaaattcattaggttttagctcaaatgaatttatttgtcttgcctgtgttctttttagcatctatgtttttgtatctggagagttcatgttgagacaatgtatgcaattgtatttggagagttgatgtttaggcaatttatgcacaatttagatggagtctgtcgagagtaattttatgagaaattgagctgcaatataaaaattggctttgagcctttcaagctttcttc</dnaseqindica>

External Link(s)

NCBI Gene:Os11g0113700, RefSeq:Os11g0113700